KEGG   Capra hircus (goat): 102186416
Entry
102186416         CDS       T02910                                 

Gene name
SPI1
Definition
(RefSeq) Spi-1 proto-oncogene
  KO
K09438  transcription factor PU.1
Organism
chx  Capra hircus (goat)
Pathway
chx04380  Osteoclast differentiation
chx05166  Human T-cell leukemia virus 1 infection
chx05200  Pathways in cancer
chx05202  Transcriptional misregulation in cancer
chx05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:chx00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102186416 (SPI1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102186416 (SPI1)
   05202 Transcriptional misregulation in cancer
    102186416 (SPI1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    102186416 (SPI1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102186416 (SPI1)
Transcription factors [BR:chx03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    102186416 (SPI1)
SSDB
Motif
Pfam: Ets p47_phox_C
Other DBs
NCBI-GeneID: 102186416
NCBI-ProteinID: XP_017914594
LinkDB
Position
15
AA seq 271 aa
MLQACKMEGFPLVPPQPSEDLVPYDTDLYQRQTHEYYPYLSSDGESHSDHYWDFHPHHVH
SEFESFAENHFTELQSVQPPQLQQLYRHMELEQMHVLDTPMAPPHASLSHQVSYLPRMCL
PYPSLSPARPSSDEEEGERQSPPLEVSDGEADGLEPGPGLLHGETGSKKKIRLYQFLLDL
LRSGDMKDSIWWVDKDKGTFQFSSKHKEALAHRWGIQKGNRKKMTYQKMARALRNYGKTG
EVKKVKKKLTYQFSGEVLGRGGLAERRHPPH
NT seq 816 nt   +upstreamnt  +downstreamnt
atgttacaggcgtgcaaaatggaagggtttcccctcgtcccccctcagccatcggaagac
ctagttccctatgacacggatctctaccaacgccaaacgcacgaatattacccctatctc
agcagtgatggagaaagccacagcgaccattactgggacttccatccacaccacgtgcac
agcgagttcgagagcttcgccgagaaccacttcacggagctgcagagcgtccagccccca
cagctgcagcagctctaccgccacatggagctggagcagatgcacgtgctcgacaccccc
atggctcctccccacgccagcctcagtcaccaggtctcctacctgccccggatgtgcctg
ccgtacccctcactgtctcctgcccggcccagctcggatgaagaggagggggagcggcag
agccccccgctggaggtgtccgacggggaggccgacggcctggagccagggcctggcctc
ctgcacggagagacaggcagcaagaagaagatccgcctgtaccagttcctgctggacctg
ctgcgcagcggcgacatgaaggacagcatctggtgggtggacaaggacaagggtacgttc
cagttctcgtccaagcacaaggaggcgctggcgcaccgctggggcatccagaagggcaac
cgcaagaagatgacctaccagaagatggcccgagcgctgcgcaactacggcaagacgggc
gaggtcaagaaggtgaagaagaagctcacgtaccagttcagcggggaggtgctgggccgc
gggggcctggccgagcggcgccacccgccccactga

DBGET integrated database retrieval system