KEGG   Capra hircus (goat): 102186731
Entry
102186731         CDS       T02910                                 

Gene name
SIKE1
Definition
(RefSeq) suppressor of IKBKE 1
  KO
K12656  suppressor of IKK-epsilon
Organism
chx  Capra hircus (goat)
Pathway
chx04622  RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:chx00001]
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    102186731 (SIKE1)
SSDB
Motif
Pfam: SIKE DUF4250 Spectrin YabA
Other DBs
NCBI-GeneID: 102186731
NCBI-ProteinID: XP_005677889
UniProt: A0A452ELT8
LinkDB
Position
3
AA seq 207 aa
MSCTIEKILTDAKTLLERLREHDAAAESLVDQSAALHRRVAAMREAGTALPDQYQEDASD
IKDMSKYKPHILLSQENTQIRDLQQENRELWVSLEEHQDALELIMSKYRKQMLQLMVAKK
AADAEPVLKAHQSHSAEIENQIDRICEMGEVMRKAVQMDDDQFCKIQEKLAQLELENKEL
RELLSISSESLQVRKESSVDTASQAIK
NT seq 624 nt   +upstreamnt  +downstreamnt
atgagctgcaccatcgagaagattctgacagacgctaagactctactggagaggctgagg
gagcacgatgcggccgccgagtcactggtggatcagtcagcggctctgcaccggcgggta
gccgctatgcgggaggcggggacagcgcttccggaccagtatcaagaggatgcatccgat
ataaaggacatgtccaaatacaaacctcacattctgctgtcccaagagaatacacagatt
agagacttgcagcaggaaaacagagagctgtgggtttccttggaggaacaccaggatgct
ttggaactcatcatgagcaaataccgaaaacagatgttacaattaatggttgctaaaaaa
gcagcggatgctgaaccggtcctgaaagctcaccagtctcactctgcagaaattgagaat
cagattgacagaatctgtgaaatgggagaagtgatgaggaaagcagttcaaatggatgat
gaccaattttgtaagattcaggaaaaactagcacaattagagcttgaaaataaggaactt
cgagaattattgtccatcagcagtgagtctcttcaggtcaggaaggaaagctcagtggac
actgcttcccaagccatcaaataa

DBGET integrated database retrieval system