KEGG   Capra hircus (goat): 102187179
Entry
102187179         CDS       T02910                                 

Gene name
RNF125
Definition
(RefSeq) ring finger protein 125
  KO
K12170  E3 ubiquitin-protein ligase RNF125 [EC:2.3.2.27]
Organism
chx  Capra hircus (goat)
Pathway
chx04622  RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:chx00001]
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    102187179 (RNF125)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:chx04121]
    102187179 (RNF125)
Enzymes [BR:chx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     102187179 (RNF125)
Ubiquitin system [BR:chx04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    102187179 (RNF125)
SSDB
Motif
Pfam: zf_C2HC_14 zf-Di19 zf-C3HC4_2 zf-RING_UBOX zf-C3HC4_4 zf-C3HC4 zf-RING_2 zf-C3HC4_3 zf-RING_5 U-box Prok-RING_4 zf-Nse zf-RING_10 zf-RING_6 Rad50_zn_hook zf-rbx1 PHD_4 zf-C2H2_4 DZR
Other DBs
NCBI-GeneID: 102187179
NCBI-ProteinID: XP_017895267
UniProt: A0A452E2J9
LinkDB
Position
24
AA seq 232 aa
MGSVLSSDSGKSAPASATPRALERRGDPELPVTSFDCSVCLEVLHHPVRTRCGHVFCRSC
IATSLKNNKWTCPYCRAYLPSEGVPAADVAKRMKSEFRNCTECDTLVCLSEMRAHIRTCQ
KYIDKYGPLQELRETTTRCVCPFCQKELDEDSLLDHCITHHRSERRPVFCPLCRLVPNEN
RSSFNGSLIRHLQVSHTLFYDDFLDFNIIEEALIQRVLDRSLLEYVNHSNTA
NT seq 699 nt   +upstreamnt  +downstreamnt
atgggctccgtactgagcagcgatagcgggaaatctgcgcccgcctcggccaccccgcgg
gccctggagcgccggggggaccccgagctgcccgtcacgtccttcgactgttctgtgtgc
ctggaagtgttgcaccaccccgttcggacccgctgtggccacgtattctgccgttcttgc
atcgctaccagtctaaagaacaataagtggacctgtccttactgccgggcctatcttcct
tccgaaggcgttccagcagctgatgtcgccaagagaatgaaatccgagttccggaactgc
accgaatgtgacactctggtttgcctcagtgaaatgagagcacacataagaacatgccag
aagtacatagataagtacggaccactgcaagagctcagagagacaacaacaaggtgtgta
tgtcctttttgtcagaaggaattggatgaagacagtttgctggatcattgcattactcat
cacagatcagaaaggagacctgtgttctgtccgctttgccgtttagtacctaatgagaat
cgaagcagcttcaatggcagcttaataagacatttgcaagtcagtcacactttgttttat
gatgatttcttagatttcaatataattgaggaagctcttatccaaagggtcttagaccgg
tcacttctggaatacgtgaatcactcgaataccgcataa

DBGET integrated database retrieval system