KEGG   Capra hircus (goat): 102187383
Entry
102187383         CDS       T02910                                 

Gene name
EP300
Definition
(RefSeq) E1A binding protein p300
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
chx  Capra hircus (goat)
Pathway
chx04024  cAMP signaling pathway
chx04066  HIF-1 signaling pathway
chx04068  FoxO signaling pathway
chx04110  Cell cycle
chx04310  Wnt signaling pathway
chx04330  Notch signaling pathway
chx04350  TGF-beta signaling pathway
chx04520  Adherens junction
chx04630  JAK-STAT signaling pathway
chx04720  Long-term potentiation
chx04916  Melanogenesis
chx04919  Thyroid hormone signaling pathway
chx04922  Glucagon signaling pathway
chx04935  Growth hormone synthesis, secretion and action
chx05016  Huntington disease
chx05152  Tuberculosis
chx05161  Hepatitis B
chx05164  Influenza A
chx05165  Human papillomavirus infection
chx05166  Human T-cell leukemia virus 1 infection
chx05167  Kaposi sarcoma-associated herpesvirus infection
chx05200  Pathways in cancer
chx05203  Viral carcinogenesis
chx05206  MicroRNAs in cancer
chx05211  Renal cell carcinoma
chx05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102187383 (EP300)
   04330 Notch signaling pathway
    102187383 (EP300)
   04350 TGF-beta signaling pathway
    102187383 (EP300)
   04630 JAK-STAT signaling pathway
    102187383 (EP300)
   04066 HIF-1 signaling pathway
    102187383 (EP300)
   04068 FoxO signaling pathway
    102187383 (EP300)
   04024 cAMP signaling pathway
    102187383 (EP300)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102187383 (EP300)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102187383 (EP300)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    102187383 (EP300)
   04935 Growth hormone synthesis, secretion and action
    102187383 (EP300)
   04919 Thyroid hormone signaling pathway
    102187383 (EP300)
   04916 Melanogenesis
    102187383 (EP300)
  09156 Nervous system
   04720 Long-term potentiation
    102187383 (EP300)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102187383 (EP300)
   05206 MicroRNAs in cancer
    102187383 (EP300)
   05203 Viral carcinogenesis
    102187383 (EP300)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    102187383 (EP300)
   05215 Prostate cancer
    102187383 (EP300)
  09164 Neurodegenerative disease
   05016 Huntington disease
    102187383 (EP300)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102187383 (EP300)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102187383 (EP300)
   05161 Hepatitis B
    102187383 (EP300)
   05164 Influenza A
    102187383 (EP300)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102187383 (EP300)
   05165 Human papillomavirus infection
    102187383 (EP300)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:chx03000]
    102187383 (EP300)
   03036 Chromosome and associated proteins [BR:chx03036]
    102187383 (EP300)
   03029 Mitochondrial biogenesis [BR:chx03029]
    102187383 (EP300)
Enzymes [BR:chx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102187383 (EP300)
Transcription factors [BR:chx03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain CBP
    102187383 (EP300)
Chromosome and associated proteins [BR:chx03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    102187383 (EP300)
Mitochondrial biogenesis [BR:chx03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    102187383 (EP300)
SSDB
Motif
Pfam: HAT_KAT11 KIX Creb_binding zf-TAZ DUF902 Bromodomain ZZ KIX_2 Npa1
Other DBs
NCBI-GeneID: 102187383
NCBI-ProteinID: XP_017904300
UniProt: A0A452F2D2
LinkDB
Position
5
AA seq 2411 aa
MAENVVEPGPPSAKRPKLSSPALSASASDGTDFGSLFDLEHDLPDELINSTELGLTNGGD
ISQLQTSLGIVQDAASKHKQLSELLRSGSSPNLNMGVGGPGQGMASQAQQNSPGLGLINS
MVKSPMAQAGLTSPNMGMGTSGPNQGPTPSATGMMSSPVNQPAMGMNTGMNAGMNPGMLT
AGSGQGMMPNQVMNGSIGAGRGRPNMQYPNPGMGNAGNLMTEPLQQGSPQMGGQTGLRGP
QPLKMGMMNNPNPYGSPYTQNSGQQMGASGLGLQIPTKSVLPNSLSPFAMDKKAVPGGGM
PNMGQQQAPQVQQPGLVAPVAQGMGSGAHTADPEKRKLIQQQLVLLLHAHKCQRREQANG
EVRQCNLPHCRTMKNVLNHMTHCQSGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLKN
AGDKRNQQSILTGAPVGLGNTSSLGVGQQSTPSLSTVSQIDPSSIERAYAALGLPYQVNQ
MPTQPQVQAKNPQNQQSGQSPQGMRPMSNMSASPMGVNGGVGVQPSNLLSDSMLHSAINS
QNPMMSDNGSVASLGPMPTAAQPSSTGIRKQWHEDITQDLRNHLVHKLVQAIFPTPDPAA
LKDRRMENLVAYARKVEGDMYESANNRAEYYHLLAEKIYKIQKELEEKRRTRLQKQNMLP
SAASMVPVMNTGPNMGQPQPGMTSNGPLPDPSMIRGNVPNQMMPRVTPQPGLNQFGQMNM
PQPPIGPRQTSPLQHHVQLAQTGTLNPPMGYGPRMQQPSSQSQFLPQTQFSTQGMNVTNM
PLAPSGGQAPVSQAQMSSSSCPVNSPIMPPGSQGSHIHCPPLPQPALHQNSPSPVPSRTP
TPHHTPPSIGAQQPPATAIPAPVPTPPAMPPGPQSQVLHPPPRQTPTPPPTQLPPQVQPS
LPAAPSVDQAQQQPLSQQSTAASVPTPTAPLLPPQPATPLSQPAVSIEGQVSNPPSTSST
EVNSQTIPEKQPSQEVKMEPKMEVEAPEPADTQPEDIPEPKAEDCKVEPTESEERGTELK
TETKEEEDQPSTSATQSSPAPGQSKKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVD
PQLLGIPDYFDIVKSPMDLSTIKRKLDTGQYQEPWQYVDDIWLMFNNAWLYNRKTSRVYK
YCSKLSEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDATYYSYQNRYHF
CEKCFNEIQGESVSLGDDPSQPQTTINKEQFSKRKNDTLDPELFVECTECGRKMHQICVL
HHEIIWPSGFVCDGCLKKTARTRKENKFSAKRLPSTRLGTFLENRVNEFLRRQNHPESGE
VTVRVVHASDKTVEVKPGMKARFVDSGEMAESFPYRTKALFAFEEIDGVDLCFFGMHVQE
YGSDCPPPNQRRVYISYLDSVHFFRPKCLRTAVYHEILIGYLEYVKKLGYTTGHIWACPP
SEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAVSERIVHDYKDILKQATEDRLTSAKE
LPYFEGDFWPNVLEESIKELEQEEEERKREENTSNESTDVTKGDSKNAKKKNNKKTSKNK
SSLSRGNKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLIAGPAANSLPPIVDPDPLIP
CDLMDGRDAFLTLARDKHLEFSSLRRAQWSTMCMLVELHTQSQDRFVYTCNECKHHVETR
WHCTVCEDYDLCITCYNTKNHDHKMEKLGLGLDDESNNQQAAATQSPGDSRRLSIQRCIQ
SLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQENK
CPVPFCLNIKQKLRQQQLQHRLQQAQMLRRRMASMQRTGVVGQQQGLPSPTPATPTTPTG
QQPTTPQTPQPPPPSQPQPTPPNNMPPYLPRTQAAGPVSQGKAAGQVTPPTPPQTAQPPL
PGPPPAAVEMAMQIQRAAETQRQMAHVQIFQRPIQHQMPQMTPMAPMGMNPPPMARGPGG
HLEPGMGPTGMQQQPPWAQGGLPPPQQLQSGMPRPAMMSVSQHGQPLNMPPQTGLGQVGV
SPLKPGTVSQQALQNLLRTLRSPSSPMQQQQVLSILHANPQLLAAFIKQRAAKYANSNPQ
PLPGQPGLQPPAMPGQQGVHPSPAMQNLNPMQAGVPRAGLPQQPTQQQQLPPPMGGMSPQ
AQQMNMNHSTMPSQFRDILRRQQMLQQQQQGAGPGMGPGLANHNQFQPPQGVGYPAPQQQ
PPPRMQHHMQQMPQGNMGQMGQLPQALGAEAGASLQAYQQRLLQQQMGSPAQPNPMSPQQ
HMLPSQAQSPHLQGQQIPSLSNQVRSPQPVPSPRPQSQPPHSSPSPRMQPQPSPHHVSPQ
TSSPHPGLVAAQGNPMEQGHFASPDQNSMLSQLASNPGMANLHGASATDLGLGTDNSDLN
SNLSQSTLDIH
NT seq 7236 nt   +upstreamnt  +downstreamnt
atggccgagaatgtcgtggaaccggggccgccttcagccaagcggcctaaactctcatct
ccggccctctcggcgtccgccagcgatggcacagattttggctctctgtttgacttggag
cacgacttaccagatgaattaatcaactctacagaattgggactaaccaatggtggtgat
attagtcagcttcagacaagtcttggcatagtacaagatgcagcctctaaacataaacaa
ctgtcagaattgctacggtctggtagttcccctaacctcaatatgggggttggtggccca
ggccaaggcatggccagccaagcccaacagaacagtcctggattaggtttgataaatagc
atggtcaaaagcccaatggcccaggcaggcttgacttctcccaacatggggatgggcact
agtggaccaaatcagggtcccacgccgtctgcaacaggtatgatgagcagtccagtcaat
cagcctgccatgggaatgaacacggggatgaatgctggcatgaatcctggaatgttgact
gccggcagtggccaagggatgatgcctaatcaagtcatgaacggttcaattggagcaggc
cgggggcgacctaatatgcagtacccaaacccgggcatgggaaatgctggcaacttaatg
actgagccgctgcagcaaggctctccccagatgggaggacagacgggactgagaggcccc
cagcctcttaagatgggaatgatgaacaaccctaatccttacggttcaccatacactcag
aattctggacagcagatgggagccagtggccttggtctccagattccgacaaagtctgta
ctaccaaatagcttatctccatttgcaatggacaaaaaggcagttcctggtggaggaatg
cccaatatgggccagcagcaggccccacaggtccagcagccaggcctggtggctccggtg
gcccaggggatgggttctggggcacatacggctgatccggagaagcgcaagctcatccag
cagcagcttgtcctcctcctgcacgctcacaagtgccagcgccgggagcaggccaacggg
gaggtgaggcagtgcaaccttccccactgtcgaaccatgaagaacgtccttaaccacatg
acacactgccagtcgggcaagtcctgccaagtggcacactgtgcatcttctcgacaaatc
atttcacactggaagaattgtacaaggcatgattgtcctgtgtgtctaccccttaaaaat
gctggagataagagaaatcaacagtcaattctgactggagcaccagttggacttggcaat
actagctctctaggggtgggtcagcagtccactcccagcctaagcactgtcagtcagatt
gatcccagctctatagaaagagcctatgcagcccttggactgccctatcaagtaaatcag
atgccgacccagccccaggtgcaagcgaagaatccgcagaaccagcagtctgggcagtct
ccccaagggatgcggcctatgagcaacatgagtgctagtcctatgggagtaaatggaggt
gtaggggttcaaccgtcgaatcttctttctgactcgatgttgcattcagccataaattct
caaaacccaatgatgagtgacaatggcagtgtggcctctctgggtcctatgccaacagca
gctcaaccatccagtactggaattcggaagcaatggcatgaagatattactcaggatctt
cgaaatcatcttgtccacaaacttgttcaagccatatttcccactccggatcctgctgct
ttaaaagacagacggatggaaaacctagttgcatatgcccggaaagtggaaggggacatg
tatgaatcggcaaacaatcgagcggaatactaccacctgctagctgagaagatctataag
attcagaaggaactagaagaaaagcgaaggactagactacagaaacagaacatgctacca
agtgctgcaagcatggtgccagttatgaacacagggcctaacatggggcagccgcaacca
ggaatgacttctaatggccccctccctgatccatctatgatccgtggcaatgtgccaaac
cagatgatgcctcgggtaactccacagcctggtttgaatcaatttggccagatgaatatg
cctcagccgcctatcggaccccggcaaacctctcctcttcagcaccatgtacagttagct
caaactggaacacttaacccgcctatgggctacgggcctcgcatgcagcagccttccagc
cagagccagtttcttcctcagactcaattctcaacacagggaatgaatgtaacaaatatg
cctttggctccgtctggcggtcaagcaccagtgtctcaagcacagatgtccagttcttcc
tgtcctgtgaactctcctataatgcctcccgggtctcaagggagccacattcactgtccc
cctctccctcaaccagctctgcatcagaactcaccctcccccgtacctagtcgcaccccc
acccctcaccacactccccctagcataggggctcagcagccaccagcaacagcaatccca
gcccctgttcctacgcctccagccatgccacctggcccacagtcccaggttctccatccg
cctccaagacagacgcctacgccgccaccaacgcagcttcctccccaagtgcagccttcg
cttcctgctgctccctcagtcgaccaggcgcagcagcagcctctgtcccagcaaagcaca
gcagcctctgtgcccaccccgaccgcacccctgctgcctccgcagccggcaactccactt
tcccagccagctgtcagcatcgaagggcaggtatcaaaccctccatctactagtagcacg
gaagtgaattctcagaccattcctgagaagcagccttcacaggaagtaaaaatggagcct
aaaatggaagtggaggcaccagaaccagcagatactcagccggaggatattccagagcct
aaagcagaagactgtaaagtagaacctacagaaagcgaagagcgaggcactgaattaaaa
actgagacgaaagaggaagaagaccagccaagtacttcagcgacccagtcatctccagcc
ccgggacagtcgaagaagaagattttcaaacctgaagagttacggcaggcactaatgcca
acattggaggcactttaccgacaggatccggaatcccttccctttcgtcagcctgtggac
cctcagcttctaggaatccctgattactttgatattgtgaagagccctatggatctttct
accatcaagaggaagttagacactggacagtatcaggagccctggcagtatgtggatgac
atttggctcatgttcaacaatgcttggttatataatcggaaaacatcacgggtgtacaaa
tactgctccaagctgtctgaggtctttgaacaagaaattgaccctgtcatgcaaagcctt
ggatactgttgtggcagaaagttggagttctctccacagacactctgttgctatggcaaa
cagttatgcacaatccctcgtgatgccacttactacagttatcagaacaggtatcatttc
tgtgagaagtgtttcaatgaaatccaaggggagagcgtttctttgggggatgacccttcc
caacctcaaactacaataaataaagaacaattttcaaagagaaaaaatgatactctggat
cctgaactgtttgttgagtgtacagagtgtgggagaaagatgcatcagatctgtgtcctt
catcatgagatcatctggccatcgggatttgtctgtgatggttgtttaaagaagactgca
cgaactagaaaagaaaataaattttctgctaaaagactgccatctaccaggcttgggaca
tttctggagaatcgtgtgaatgagtttctgaggcgacaaaatcaccctgagtcaggagag
gtcactgttcgagtagttcatgcttctgacaaaactgtggaagtcaaaccaggcatgaaa
gcaagatttgtagatagtggagagatggcagaatcctttccatatcgaaccaaagccctc
tttgccttcgaagaaatcgatggtgttgacttgtgcttctttggtatgcatgttcaggag
tatggctctgactgccctccgcccaaccagaggagagtatacatatcatacctcgatagt
gttcacttcttccgtcctaaatgcttgaggactgcagtctatcatgaaatcctaattgga
tatttggaatatgtcaagaaattaggatacacaacagggcatatttgggcgtgtccgcca
agtgaaggagatgactacatcttccattgccacccccctgaccagaagatacccaagccc
aagcgactgcaggagtggtacaaaaagatgctcgacaaagctgtgtccgagcgaatcgtc
catgattataaggatattttaaaacaagctactgaagatcgattgacaagcgcgaaggaa
ttgccttactttgagggagatttctggcccaatgtcctggaagagagcattaaggaactg
gagcaggaggaggaggagcggaagcgggaggagaacaccagcaatgagagcacagatgtg
acaaagggagacagcaaaaacgctaaaaagaaaaacaacaagaaaactagcaaaaacaag
agcagcctgagtcggggcaataagaagaagccaggcatgcccaacgtatccaacgacctc
tcacagaagttgtatgccaccatggagaagcacaaagaggtcttctttgtgatccgtctc
atcgctggccctgccgccaactccctgcctcccattgttgaccccgaccccctcatcccc
tgtgacctgatggatgggcgggatgcctttctcaccctcgcaagggacaagcacctggag
ttctcgtcactgcgaagagcccagtggtccaccatgtgcatgctggttgagctgcacacc
cagagccaggaccgctttgtctacacctgcaacgagtgcaagcaccacgtggagactcgc
tggcattgcaccgtgtgtgaggattatgacttgtgtatcacctgctacaacactaaaaac
cacgaccacaagatggagaagctcgggctggggcttgatgacgagagcaacaaccagcag
gccgccgccacgcagagccccggagactcccgccgcctgagcatccagcgctgcatccag
tcgctggtgcacgcctgccagtgccgcaacgccaactgctcgctgccgtcctgccagaag
atgaagcgggtggtgcagcacaccaagggctgcaagcgcaagaccaacggcggctgcccc
atctgcaaacagctcatcgccctgtgctgctaccacgccaagcactgccaggagaacaag
tgccccgtgcccttctgcctcaacatcaagcagaagctccggcagcagcagctgcagcac
cggctccagcaggcccagatgctgcgccggcggatggccagcatgcagcggactggcgtg
gtggggcagcagcagggcctgccctccccgacccctgccaccccaaccacgccgacaggc
cagcagcccaccacgccgcagacaccccagcccccgcccccctctcagccccagcccaca
cctcccaacaacatgccgccctacttgcctaggactcaagctgctggcccggtgtcccag
ggcaaggcagcaggccaagtgacccccccgaccccgcctcagactgctcagcccccactt
ccgggacctccacctgcagcagtggaaatggccatgcagattcagagggcagccgagacg
caacgccagatggcccacgtgcaaatctttcagcggccaatccagcaccagatgccgcag
atgactcccatggcccccatgggtatgaacccgccccccatggccagagggcctggtggg
catttggagccagggatggggcccaccggcatgcagcagcaacccccgtgggcccaggga
ggactgcccccgccccagcagctgcagtccgggatgccccggccagccatgatgtcggtg
tcacagcatgggcagcccctgaacatgcctccccagacgggcctgggccaggtaggtgtg
agccctctcaagccaggcactgtgtctcaacaagccttacagaacctcctgcggactctc
aggtctcccagctcccccatgcagcagcaacaggtgctcagtatccttcatgccaacccc
cagctattggctgcgttcatcaaacagcgggctgccaagtacgccaactccaacccgcag
ccgctccccgggcagccaggcctgcagcctcccgccatgccaggtcagcagggggtccac
cccagccccgccatgcagaacttgaaccccatgcaggcaggtgtcccgagggctggcttg
ccccagcagcccacacagcagcaacagctcccaccacccatgggtgggatgagcccgcag
gctcagcagatgaacatgaatcacagcaccatgccctcgcaattccgagacatcttgagg
cgacagcagatgttgcagcagcagcagcagggagcggggccagggatgggcccggggctg
gccaaccacaaccagttccagcccccgcagggcgtgggctaccctgccccacagcagcag
ccaccgccacgaatgcagcaccacatgcagcagatgccgcaagggaacatgggacagatg
ggccagctcccgcaggccctgggagcagaggcgggagccagtctacaggcctaccagcag
cggctccttcagcaacagatgggctcgccggcccagcccaaccccatgagcccccagcag
cacatgctcccgagtcaggctcagtccccacacctccaaggccagcagatcccgtctctc
tccaatcaagtgcgatctccccagcctgtcccttctccgcggccgcagtcccagcccccc
cactccagcccttccccacggatgcagcctcagccttctccacaccacgtctccccacag
accagttctccacatcctggactggtcgctgcccagggcaaccccatggaacaagggcat
tttgccagcccggaccagaattcgatgctctctcagctcgctagcaatccaggcatggca
aacctccatggtgcgagcgccacggacctgggactcggcaccgacaactcagacttgaat
tcaaacctctcacagagtacactagacatacactag

KEGG   Capra hircus (goat): 102187824
Entry
102187824         CDS       T02910                                 

Gene name
CREBBP
Definition
(RefSeq) CREB binding protein
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
chx  Capra hircus (goat)
Pathway
chx04024  cAMP signaling pathway
chx04066  HIF-1 signaling pathway
chx04068  FoxO signaling pathway
chx04110  Cell cycle
chx04310  Wnt signaling pathway
chx04330  Notch signaling pathway
chx04350  TGF-beta signaling pathway
chx04520  Adherens junction
chx04630  JAK-STAT signaling pathway
chx04720  Long-term potentiation
chx04916  Melanogenesis
chx04919  Thyroid hormone signaling pathway
chx04922  Glucagon signaling pathway
chx04935  Growth hormone synthesis, secretion and action
chx05016  Huntington disease
chx05152  Tuberculosis
chx05161  Hepatitis B
chx05164  Influenza A
chx05165  Human papillomavirus infection
chx05166  Human T-cell leukemia virus 1 infection
chx05167  Kaposi sarcoma-associated herpesvirus infection
chx05200  Pathways in cancer
chx05203  Viral carcinogenesis
chx05206  MicroRNAs in cancer
chx05211  Renal cell carcinoma
chx05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102187824 (CREBBP)
   04330 Notch signaling pathway
    102187824 (CREBBP)
   04350 TGF-beta signaling pathway
    102187824 (CREBBP)
   04630 JAK-STAT signaling pathway
    102187824 (CREBBP)
   04066 HIF-1 signaling pathway
    102187824 (CREBBP)
   04068 FoxO signaling pathway
    102187824 (CREBBP)
   04024 cAMP signaling pathway
    102187824 (CREBBP)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102187824 (CREBBP)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102187824 (CREBBP)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    102187824 (CREBBP)
   04935 Growth hormone synthesis, secretion and action
    102187824 (CREBBP)
   04919 Thyroid hormone signaling pathway
    102187824 (CREBBP)
   04916 Melanogenesis
    102187824 (CREBBP)
  09156 Nervous system
   04720 Long-term potentiation
    102187824 (CREBBP)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102187824 (CREBBP)
   05206 MicroRNAs in cancer
    102187824 (CREBBP)
   05203 Viral carcinogenesis
    102187824 (CREBBP)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    102187824 (CREBBP)
   05215 Prostate cancer
    102187824 (CREBBP)
  09164 Neurodegenerative disease
   05016 Huntington disease
    102187824 (CREBBP)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102187824 (CREBBP)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102187824 (CREBBP)
   05161 Hepatitis B
    102187824 (CREBBP)
   05164 Influenza A
    102187824 (CREBBP)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102187824 (CREBBP)
   05165 Human papillomavirus infection
    102187824 (CREBBP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:chx03000]
    102187824 (CREBBP)
   03036 Chromosome and associated proteins [BR:chx03036]
    102187824 (CREBBP)
   03029 Mitochondrial biogenesis [BR:chx03029]
    102187824 (CREBBP)
Enzymes [BR:chx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102187824 (CREBBP)
Transcription factors [BR:chx03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain CBP
    102187824 (CREBBP)
Chromosome and associated proteins [BR:chx03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    102187824 (CREBBP)
Mitochondrial biogenesis [BR:chx03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    102187824 (CREBBP)
SSDB
Motif
Pfam: HAT_KAT11 KIX Creb_binding zf-TAZ DUF902 Bromodomain ZZ KIX_2 Npa1
Other DBs
NCBI-GeneID: 102187824
NCBI-ProteinID: XP_017895733
UniProt: A0A452F179
LinkDB
Position
25
AA seq 2435 aa
MAENLLDGPPNPKRAKLSSPGFSANDSTDFGSLFDLENDLPDELIPNGGELSLLNSGNLV
PDAASKHKQLSELLRGGSSSSINPGIGNVSASSPAQQGLGSQAQGQPSSTNMASLGAMGK
SPLNQGDSSAPSLPKQAASTSGPTPPASQALNPQAQKQVGLVTSSPATSQTGPGICMNAN
FNQTHPGLLNSNSGHSLMNQAQQGQAQVMNGSLGAAGRGRGAGMPYPTPAMQGATSSVLA
ETLTQVSPQMASHAGLSTAQAGGMSKMGMTGNTSPFGQAFSQTGGQQMGAPGVNPQLPSK
QSMVNSLPPFAADIKNASVTNVPNMSQMQTSVGIVPTQAIATGPTADPEKRKLIQQQLVL
LLHAHKCQRREQANGEVRACSLPHCRTMKNVLNHMTHCQAGKACQVAHCASSRQIISHWK
NCTRHDCPVCLPLKNASDKRNQQTILGSPASGIQNTIGSVGTGQQNATSLSNPNPIDPSS
MQRAYAALGLPYLNQPQTQLQPQVPGQQPAQPQTHQQMRSLNPLGNNPMNIPAGGITTDQ
QPPNLISESALPTSLGATNPLMNDGSNSGNIGTLSTIPAAAPPSSTGVRKSWHEHVTQDL
RSHLVHKLVQAIFPTPDPAALKDRRMENLVAYAKKVEGDMYESANSRDEYYHLLAEKIYK
IQKELEEKRRSRLHKQGILGNQPALPAPGTQPPGIPQAQPVRPPNGPMPLPVNRMQVSQG
MNSFNPISLGNVQLPQAPMGPRAASPMNHSVPMNSMGSVPGMAISPSRMPQPPNMMGAHA
NSMMAQAPTQSQFLPQSQFPSSSGALSVSSVGMGQPAAQAGVPQGQVPGAALPNPLNMLG
PQASQLPCPPVTQPPLHQTPPPASTAAGMPSLQHPAAPGVTPPQPAAPTQPSTPASSSGQ
TPTPTPGSVPSASQTQSTPTVQAAAQAQVTPQPQTPVQPPSVATPQSSQQQPTPVHTQPP
GTPLSQTAASIDNRVPTPSSVASAETNSQQPGPEVPLLEMKAEIKTEDTEPDAGEPKGEP
GAAMMEEDLQGSSQVKEETDPTEQKSEPMEVDEKKTEVKVEAKEEEEGSTNGTASQSTSP
SQPRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLST
IKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLG
YCCGRKYEFSPQTLCCYGKQLCTIPRDAAYYSYQNRYHFCEKCFTEIQGENVTLGDDPSQ
PQTTISKDQFEKKKNDTLDPEPFVDCKECGRKMHQICVLHYDIIWPSGFVCDNCLKKTGR
TRKENKFSAKRLQTTRLGNHLEDRVNKFLRRQNHPEAGEVFVRVVASSDKTVEVKPGMKS
RFVDSGEMSESFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSDCPPPNTRRVYISYLDSI
HFFRPRCLRTAVYHEILIGYLEYVKKLGYVTGHIWACPPSEGDDYIFHCHPPDQKIPKPK
RLQEWYKKMLDKAFAERIIHDYKDILKQATEDRLTSAKELPYFEGDFWPNVLEESIKELE
QEEEERKKEESTAASETTEGSQGDSKNAKKKNNKKTNKNKSSISRANKKKPSMPNVSNDL
SQKLYATMEKHKEVFFVIHLHAGPVINTLPPIVDPDPLLSCDLMDGRDAFLTLARDKHWE
FSSLRRSKWSTLCMLVELHTQGQDRFVYTCNECKHHVETRWHCTVCEDYDLCINCYNTKS
HTHKMVKWGLGLDDEGGSQGEPQSKSPQESRRLSIQRCIQSLVHACQCRNANCSLPSCQK
MKRVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFCLNIKHKLRQQQIQH
RLQQAQLMRRRMATMNTRNVPQQSLPSPTSAPPGTPTQQPSTPQTPQPPAQPQPSPVSMS
PAGFPSVTRTQPPTTVSTGKPTNQVPAPPPPAQPPPAAVEAARQIEREAQQQQHLYRVNI
NNGMPPGRTGMVTPVSQMAPVGLNVPRPSQVSGPVVPTLPAGQWQQAPIPQQQPMPGMPR
PVMSMQAQPAVAGPRMSGVQPPRSISPGALQDLLRTLKSPSSPQQQQQVLNILKSNPQLM
AAFIKQRTAKYVASQPGLQPQPGLQAQPGLHQQPGLQNLNAMQASGPRPGVPPQQQAMGG
LNPQGQALNIMNAGHNPSMASMNPQYREMLRRQLLQQQQQQQQQQQQQQQGGAGMAGGMA
GHGQFPQPPGPAGYPPAMPQQRVQQHLPMQGSAMGPMAAPMGQLGQMGQPGLGADSTPNI
QQALQQRILQQQQMKQQMGSPGQPNPMSPQQHMLSGQPQASHLPGQQMATSLSSQVRSPA
PVQSPRPQSQPPHSSPSPRIQPQPSPHHVSPQTGSPHPGLAVTMASSIDQGHLGNPEQSA
MLPQLNTPNRSALSSELSLVGDTTGDTLEKFVEGL
NT seq 7308 nt   +upstreamnt  +downstreamnt
atggccgagaacttgctggacggaccgcccaaccccaaacgagccaaactcagctcgccc
ggcttctcggcgaatgacagcacagattttggatcattgtttgacttggaaaatgatctt
cccgatgagttgatccccaatggaggagaattaagccttttaaacagtgggaacctcgtt
ccagatgctgcttccaaacataaacaactgtccgagctcctgcgaggcggcagcagctcc
agcatcaacccgggaataggcaatgtgagtgccagcagccccgcgcaacaaggcctcggc
agccaggcccaggggcagcccagcagtaccaacatggccagtctgggtgccatgggcaag
agccctctgaaccagggagattcttcggcccccagcctgcccaagcaggcagccagcacc
tccgggcccactcctcctgcttcccaagcactgaatccgcaagcacaaaagcaagtgggg
ctggtaaccagcagccctgccacgtcgcagacgggacctgggatctgcatgaacgcaaac
ttcaaccagacccacccaggcctcctcaatagtaactctggccacagtttaatgaaccag
gcgcagcaaggacaggcacaggtcatgaatggatctctcggggctgctggccgaggaagg
ggagctgggatgccataccctactccggccatgcagggggccacgagcagtgtgctggct
gagacgttgacccaagtttcaccgcaaatggccagtcacgcggggctgagcaccgcacag
gccggaggcatgagcaagatgggaatgactggtaacacaagtccatttggacaagccttt
agtcaaactggagggcagcagatgggagcccctggagtgaacccccagctgcctagcaag
cagagcatggtcaacagcttgcctccctttgccgcagacatcaagaacgcttcagtcacc
aacgtgccaaacatgtctcagatgcaaacatcagtgggaattgtacccacacaggcaatt
gcaacgggccccactgcagatcctgaaaaacgcaaactgatacagcagcagctggtccta
ctgcttcacgctcataaatgtcagaggcgagaacaagccaacggagaggtccgggcctgc
tcactcccacattgtcgaaccatgaaaaacgtcttgaatcacatgacgcattgtcaggct
gggaaggcttgtcaagttgcccattgtgcatcttcacgacaaatcatctctcattggaag
aactgcacacgacatgactgtcctgtttgcctccctttgaaaaatgccagtgacaagcga
aaccaacaaaccatcctggggtctccagctagtggaattcaaaacaccattggttctgtt
ggcaccggccaacagaatgccacttctttaagtaacccaaatccgatagaccccagctcc
atgcaacgagcgtatgctgctcttggactcccctacctgaaccagccccagacgcagctg
cagcctcaggttcctggccagcaaccagcacagcctcaaactcaccagcagatgaggagt
ctcaaccccctgggaaataacccaatgaacattccagcaggaggaataacaacagatcag
cagccaccaaacttgatttcagaatcagctcttccaacttcccttggggctacaaacccc
ctgatgaatgatggctcaaactctgggaacattggcacccttagcactatacctgcagca
gcacctccttccagcactggcgttcggaaaagctggcatgaacacgtcactcaggacctg
cggagccatctagtgcataaacttgtccaagccatcttcccgacacctgaccctgcagcc
ctgaaggatcgccgcatggagaacctagtggcctacgctaagaaagtggaaggggacatg
tacgagtctgccaacagcagggatgaatactatcacttactggcagagaaaatatacaag
attcaaaaagagctagaagaaaagcggagatcgcgtttacacaaacaaggcatcttgggt
aaccagccagccttaccagcccccgggacacagccccctggaataccccaggcgcagcct
gtgagacctccaaatgggcccatgcctctgccagtgaatcgtatgcaggtttctcaaggg
atgaattcatttaacccaatatccttggggaatgtacagttgccacaagcacccatggga
ccgcgtgcggcatcccccatgaaccactctgtcccgatgaacagcatgggctctgttcca
gggatggccatttctccgtcccgaatgcctcagcctccgaacatgatgggcgcgcacgcc
aacagcatgatggcccaggcgcctacgcagagccagttcctcccgcagagccagttcccg
tcatccagcggggcgctgagtgtgagcagcgtgggcatggggcagccggcggcgcaggct
ggcgttccacaggggcaggtgccgggggctgctcttcccaaccccctgaacatgcttggg
ccccaggccagccagctgccttgcccaccagtgacacagccgccactgcatcagaccccg
cctcccgcctccacggccgctggcatgccgtctctgcagcacccagcagctcccggggtg
acacccccccagccagcagcgcctacccagccatcaactcccgcgtcgtcttccgggcag
actcccaccccgactcccggctccgtgcccagcgccagccagacgcagagtactcctacg
gtccaggcagccgcccaggcccaggtgaccccgcagcctcagaccccagtgcagcctccg
tcggtggccaccccgcagtcatcgcagcagcagccgacacccgtgcacacgcagcccccc
ggcaccccgctttcccagacagcagccagcattgataacagggtccccactccatcctca
gtggccagcgccgaaaccaactcccagcagccaggccccgaggtgccactgctggagatg
aaggccgagatcaagactgaggacacagagcccgatgctggggagcccaagggagagccc
ggggctgcgatgatggaggaggacttacaaggatcttctcaagttaaagaagaaacagac
ccaacagagcagaagtcagaaccaatggaagtggatgaaaagaaaactgaagtgaaggtc
gaagctaaagaggaagaagagggcagcaccaatggcacagcctctcagtccacgtcccct
tcgcagcctcgcaagaaaatcttcaagccggaggagttgcgccaggctctgatgccaacc
ctggaagctctgtaccgacaggatccagagtccttaccttttcggcagcctgtggatcct
cagctcctgggaattccagattactttgacattgtgaagaatcccatggacctttccacc
atcaagcggaagctggatacagggcagtaccaggagccctggcagtatgtagacgacgtc
tggctcatgttcaacaatgcctggctctacaatcggaagacatcccgggtctacaagttc
tgcagcaaactcgcagaggtctttgagcaggagattgaccccgtcatgcagtcccttgga
tattgctgtggacgcaagtatgagttttccccacagactctgtgctgctacgggaagcag
ctatgtacaattcctcgagatgctgcctactacagctatcagaataggtatcacttctgt
gagaagtgtttcacagagatccagggggagaatgttaccctgggtgacgacccttcacaa
ccccagacgacaatttcaaaggatcagtttgaaaagaagaaaaatgataccttagatcct
gaaccttttgttgactgcaaggagtgtggccggaagatgcatcagatttgtgttctccac
tacgacatcatctggccttcaggctttgtatgtgacaactgcttgaagaaaacgggcaga
actcgaaaagaaaacaaattcagtgctaagagactacaaaccacacggttgggaaaccac
ctggaagaccgagtcaacaagtttttgcggcgacagaatcaccccgaagccggggaggtg
tttgtccgtgtggtggccagctcagacaagacggtggaggtcaagccagggatgaagtca
cggtttgttgattctggggagatgtcggagtctttcccgtacagaaccaaagcactcttt
gcctttgaggagattgatggggtggacgtgtgcttctttgggatgcatgtccaggaatac
ggctctgactgccccccgccaaacacaaggcgtgtgtatatatcttatctggacagtatt
catttcttccgaccccgatgcctccgaacagccgtttaccatgagatcctcattggatat
ttagagtatgtgaagaaattggggtatgtgacagggcacatctgggcctgtcccccaagt
gaaggagatgactacatcttccactgccacccccctgatcaaaaaatccccaagccgaag
cgcctgcaggagtggtataagaagatgctggacaaggccttcgccgagcgcatcatccat
gactacaaggacattttgaaacaagcaactgaagacaggctcaccagcgccaaggagctg
ccctactttgagggggacttctggcctaacgtgctggaggagagcattaaggagctggag
caggaggaggaggaaagaaagaaggaggagagcaccgcggccagtgagaccacggagggc
agccagggcgacagcaagaacgccaagaaaaagaacaacaagaaaaccaacaagaataaa
agcagcatcagccgcgccaacaagaagaagcccagcatgcccaatgtgtccaacgacctg
tcccagaaactctacgccaccatggagaagcacaaagaggtcttctttgtgatccacctc
cacgctgggcccgtcatcaacacgctgccccccatcgtcgaccccgaccccctgctcagc
tgtgacctcatggatgggcgggatgccttcctcacactggcccgtgacaagcactgggag
ttctcctccttgcggcgctccaagtggtccacgctgtgcatgctggtggagctgcacacc
cagggtcaggaccgcttcgtctacacctgcaatgagtgcaagcaccacgtggagacgcgc
tggcactgcaccgtgtgcgaggactacgacctctgcatcaactgctacaacacgaagagc
cacacccacaagatggtgaagtgggggctgggcctggacgacgagggcggcagccaaggc
gagccgcagtccaagagcccccaggagtcgcggcgcctgagcatccagcgctgcatccag
tcgctggtgcacgcctgccagtgccgcaacgccaactgctcgctgccgtcctgccagaag
atgaagcgggtggtgcagcacaccaagggctgcaagcgcaagaccaacggcggctgcccg
gtgtgcaagcagctcatcgccctctgctgctaccacgccaaacactgccaagaaaacaag
tgccccgtgcccttctgcctcaacatcaaacacaagctccgccagcagcagatccagcac
cgcctgcagcaggcccagctcatgcgccggcggatggccaccatgaacacccgcaacgtg
cctcagcagagcctgccttcccctacctcagcgccgcccgggacccccacgcagcagccc
agcacgccccagacgccgcagccccccgcccagccccagccctcgcctgtgagcatgtca
ccagccggcttccccagcgtgacccggactcagccacccacgacggtgtccaccgggaag
cccaccaaccaggtgccagccccgccgccccccgcccagcccccacccgcggcggtggag
gctgcccggcagatcgagcgggaggcccagcagcagcagcacctgtaccgggtgaacatc
aacaacggcatgcccccggggcgcacgggcatggtgaccccggttagccagatggccccc
gtgggcctgaacgtgccccggcccagccaggtcagcgggcccgtcgtgcccaccctgccg
gccgggcagtggcagcaggcgcccatcccccagcagcagccgatgccgggcatgccccgg
cccgtgatgtccatgcaggcccagccggccgtggccgggccccggatgtccggcgtgcag
ccgccccggagcatctcacccggcgccctccaggacctgctgcggaccctgaagtcgccc
agctccccgcagcagcagcagcaggtgctcaacatcctcaagtccaaccctcagctgatg
gcagctttcatcaaacagcgcacggccaagtatgtggccagccagcccggcctgcagcca
cagcccggcctccaggcccagcccggcctgcaccagcagcccggcctgcagaacctgaac
gccatgcaagccagcgggccacggcctggcgtgcctccgcagcagcaggcaatgggcggc
ctgaacccccagggccaggccctgaacatcatgaacgcaggccacaaccccagcatggca
agtatgaacccgcagtaccgagagatgctgaggaggcagctcctgcagcagcagcagcag
caacagcagcagcagcagcagcagcagcagggcggtgctggcatggctgggggcatggca
gggcatggccagttcccacagcccccgggccccgcgggctacccccccgccatgccgcag
cagcgggtgcagcagcacctccccatgcagggcagtgccatgggcccgatggcggctccg
atggggcagctcggccagatggggcagcctgggctgggcgcagacagcacccccaacatc
cagcaggccctgcagcagcggattctgcagcagcagcagatgaagcagcagatggggtcc
ccgggccagccaaaccccatgagcccccagcagcacatgctctcaggacagcctcaggcc
tcgcacctccccggccagcaaatggccacgtcccttagtagccaggtgcggtctccggcc
cctgtccagtctccgcggccccagtcccagcctccacattccagcccgtcgccacggata
cagccccagccttcaccgcaccacgtctcgccccagactggttccccccacccaggactc
gcagtcaccatggccagctccatagatcagggacacttggggaaccccgaacagagtgca
atgctcccgcagctgaacacccctaaccggagtgcgttgtccagtgagctgtccctggtc
ggcgacaccacgggagacaccctagaaaagtttgtggagggtttgtag

DBGET integrated database retrieval system