KEGG   Capra hircus (goat): 102187736Help
Entry
102187736         CDS       T02910                                 

Gene name
HDAC4
Definition
(RefSeq) histone deacetylase 4
  KO
K11406  histone deacetylase 4/5 [EC:3.5.1.98]
Organism
chx  Capra hircus (goat)
Pathway
chx04371  Apelin signaling pathway
chx05034  Alcoholism
chx05165  Human papillomavirus infection
chx05169  Epstein-Barr virus infection
chx05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    102187736 (HDAC4)
 09160 Human Diseases
  09161 Cancers
   05203 Viral carcinogenesis
    102187736 (HDAC4)
  09164 Substance dependence
   05034 Alcoholism
    102187736 (HDAC4)
  09167 Infectious diseases
   05169 Epstein-Barr virus infection
    102187736 (HDAC4)
   05165 Human papillomavirus infection
    102187736 (HDAC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:chx03036]
    102187736 (HDAC4)
Enzymes [BR:chx01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     102187736 (HDAC4)
Chromosome and associated proteins [BR:chx03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     102187736 (HDAC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl HDAC4_Gln Oxidored_nitro
Motif
Other DBs
NCBI-GeneID: 102187736
NCBI-ProteinID: XP_017895619
LinkDB All DBs
Position
3
AA seq 1089 aa AA seqDB search
MSSQSHPDGLSGRDQPVELLNPARVNHMPSTVDVASALPLPVAPPGVPMDLRLDHQFPLP
VAEPGLREQQLQQELLALKQKQQLQRQILIAEFQRQHEQLSRQHEAQLHEHIKQQQELLA
MKHQQELLEHQRKLERHRQEQELEKQHREQKLQQLKNKEKGKESAVASTEVKMKLQEFVL
NKKKALAHRNLNHCMSSDPRYWYGKTQHSSLDQSSPPQSGASASYNHPVLGMYDAKDDFP
LRKTASEPNLKLRSRLKQKVAERRSSPLLRRKDGPVVTALKKRPLDVTDSACSSAPGSAP
SSPNNSSGNVSTENGIAPTVPSIPAETSLAHRLVAREGSVGPLPLYTSPSLPNITLGLPA
TGPSTGAAGQQEAERLALPALQQRVSLFPGAHLAPYLGTAPLERDTGAAPGSLLQHVVLL
EQPPAQTPLVTDRYLAGLGALPLHAQPLVGAERVAPSVHKLRQHRPLGRTQSAPLPQSAQ
ALQHLVIQQQHQQFLEKHKQHFQQPQLHLNKMIPKPSEPARQPESHPEETEEELREHQAL
LEEPFLDRLPGQKEAHALAGVQVKQEPIESDDEETEPAREADPGQRLPTEQELLFRQQAL
LLEQQRIHQLRNYQASMEAAGIPVSFGGHRPLSRAQSSPASATFPMSVQEPPAKPRFTTG
LVYDTLMLKHQCTCGNTNSHPEHAGRIQSIWSRLQETGLRSKCECIRGRKATLEELQTVH
SETHALLYGTNPLNRQKLDSKKLLGSLTSVFVRLPCGGVGVDSDTIWNEVHSSGAARLAV
GCVVELVFKVATGELKNGFAVVRPPGHHAEESTPMGFCYFNSVAIAAKLLQQRLSVSKTL
VVDWDVHHGNGTQQAFYSDPRVLYISLHRYDDGNFFPGSGAPDEVGTGAGVGFNVNMAFT
GGLDPPMGDAEYLAAFRTVVMPIASEFAPDVVLVSSGFDAVEGHPTPLGGYNLSAKCFGY
LTKQLMGLAGGRVVLALEGGHDLTAICDASEACVSALLGNELDPLPEKVLQQRPNANAVR
SMEKVIEIHSQYWRSLQRLASTAGYSLVEAQKCENEEAETVTAMASLSVAVKAPEKRPDE
EPMEEEPPL
NT seq 3270 nt NT seq  +upstreamnt  +downstreamnt
atgagctcgcaaagccatccagatggactttctggccgagaccagccagtggagctgctc
aaccctgcccgtgtgaaccacatgcccagcaccgtggacgtggcctcggccctgcctctg
ccggtggcccccccgggggtgcccatggacctgcgcctggaccaccagttcccgctgccc
gtggcggagccgggcctccgcgagcagcagctgcagcaggagctcctggcgctcaagcag
aagcagcagctgcagagacagatcctcatcgccgagttccagcggcagcacgagcagctg
tcgcggcagcacgaggcccagctgcacgagcacatcaagcaacagcaggagctgctggcc
atgaagcaccagcaggagctgctcgagcaccagcggaagctggagcggcatcggcaggag
caggagctggagaagcagcaccgggagcagaagctgcagcagctgaagaacaaggagaag
ggcaaagagagcgccgtggccagcacggaagtgaagatgaagctgcaggagtttgtcctc
aataagaagaaggccctggctcatcggaacctgaaccactgcatgtccagcgaccctcgc
tactggtacgggaagacgcagcacagctcactggaccagagctccccgccccagagcggg
gcgtcggcctcctacaaccacccggtcctgggcatgtacgacgccaaagacgacttcccc
ctcagaaagacagcttctgaacccaacctgaaattgcgctccaggctaaagcagaaagtg
gctgagagacggagcagccccctgctgcgcaggaaagatgggccagtggtcacggctctg
aaaaagcgccccttggatgtcacagactcggcgtgcagcagtgccccaggctccgcgccc
agctcgcccaacaacagctccgggaacgtgagcaccgagaacgggatcgcgcccaccgtc
cccagcatcccggccgagaccagcctggcgcacagactcgtggcgcgagagggctcggtg
ggcccgctgcccctctacacctcaccatccctgcccaacatcacgctggggctgcccgcc
accggcccctccacgggggcagccggccagcaggaggccgagagactggccctccccgcc
ctgcagcagcgcgtctccctcttccccggcgcccacctcgccccctacctgggcacggcg
cccctggagcgtgacacaggggcggcccctggctccctgctgcagcacgtggtcctcctg
gagcagccgcctgcacagacgcccctcgtcacagaccgctatcttgcaggcctgggcgcg
ctgcccctgcacgcgcagcccctggtaggggctgagcgcgtggcaccctcggtgcacaag
ctgcggcagcaccgcccgctgggccgcacgcagtcggcgccgctgcctcagagcgcgcag
gcgctgcagcacctggtcatccagcagcagcaccagcagttcctggagaaacacaagcag
cacttccagcagccgcagctgcacctcaacaagatgatccccaaacccagcgagccagca
cggcagcccgagagccaccccgaggagacggaggaggagttgcgggagcaccaggcactc
ctggaggagcccttcctggaccggctcccggggcagaaggaggcccacgcgctggctggg
gtgcaggtgaagcaggagcccatcgagagtgatgacgaggagacggagcccgcacgggag
gcggaccccggccagcggctgcccacggagcaggagctgctcttcagacagcaagccctc
ctcctggagcagcagcggatccaccagctgaggaactaccaggcatccatggaggccgct
ggcatccccgtgtccttcggcgggcaccggcccctatcccgggcgcagtcctcccccgcg
tctgccaccttccctatgtccgtgcaggagcccccagccaagccgaggtttaccacaggc
ctcgtgtacgacacgctgatgctgaagcaccagtgcacctgcgggaacaccaacagccac
ccagagcacgccgggcgcatccagagcatctggtcgcggctgcaggagaccggcctgcga
agcaaatgtgagtgcatccgtggacggaaggccacgctggaggagctgcagacagtgcac
tcggagacgcacgccctgctctacggcacgaaccccctcaacaggcagaaactggacagt
aagaaacttctaggctcattaacgtccgtgttcgtcaggctgccctgcggtggtgtcggg
gtggacagtgataccatatggaatgaggtgcactcgtcgggggctgcccgcctggctgtg
ggctgtgtggtggagctggtcttcaaggtggccacaggggagctgaagaacggctttgct
gtggtccgccctccaggacaccacgcagaggagagcacgcccatggggttctgctacttc
aactccgtggccatcgctgccaagcttctccagcaaaggctgagcgtgagcaagaccctc
gtggtagactgggacgtgcaccacgggaacgggacccagcaggccttctacagcgacccc
cgcgtgctctacatctccctgcaccgctacgacgacggcaacttcttcccaggcagcggc
gcacccgacgaggtgggcacgggcgctggcgtgggcttcaacgtcaacatggctttcacc
ggcggcctggacccccccatgggagacgcagagtacctggcggccttcaggactgtggtc
atgccgatcgccagcgagtttgccccagatgtggtgctggtgtcctcgggcttcgatgct
gtggagggccaccccacgcccctcggaggctacaacctctccgccaaatgtttcgggtac
ctgacgaagcagctaatgggcctggccggtggccgggttgtcctggcgctagaggggggc
cacgatctcacagccatctgcgacgcctcggaagcctgcgtctctgctctgctggggaat
gagctcgatcctctcccagaaaaggtcttacagcagagacccaacgccaacgccgtgcgg
tcgatggagaaggtcattgaaatccacagccagtactggcgctccctgcagcggctcgcc
tccaccgccggctactccctggtcgaggcccagaagtgtgagaacgaggaagccgagact
gtcactgccatggcctcgctgtctgtggccgtgaaggcccctgagaagagacccgacgag
gagcccatggaagaggagccgcctctgtag

DBGET integrated database retrieval system