KEGG   Capra hircus (goat): 102187736Help
Entry
102187736         CDS       T02910                                 

Gene name
HDAC4
Definition
(RefSeq) histone deacetylase 4
  KO
K11406  histone deacetylase 4/5 [EC:3.5.1.98]
Organism
chx  Capra hircus (goat)
Pathway
chx04371  Apelin signaling pathway
chx05034  Alcoholism
chx05165  Human papillomavirus infection
chx05169  Epstein-Barr virus infection
chx05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    102187736 (HDAC4)
 09160 Human Diseases
  09161 Cancers: Overview
   05203 Viral carcinogenesis
    102187736 (HDAC4)
  09165 Substance dependence
   05034 Alcoholism
    102187736 (HDAC4)
  09172 Infectious diseases: Viral
   05169 Epstein-Barr virus infection
    102187736 (HDAC4)
   05165 Human papillomavirus infection
    102187736 (HDAC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:chx03036]
    102187736 (HDAC4)
Enzymes [BR:chx01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     102187736 (HDAC4)
Chromosome and associated proteins [BR:chx03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     102187736 (HDAC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl HDAC4_Gln Oxidored_nitro
Motif
Other DBs
NCBI-GeneID: 102187736
NCBI-ProteinID: XP_017895619
LinkDB All DBs
Position
3
AA seq 1089 aa AA seqDB search
MSSQSHPDGLSGRDQPVELLNPARVNHMPSTVDVASALPLPVAPPGVPMDLRLDHQFPLP
VAEPGLREQQLQQELLALKQKQQLQRQILIAEFQRQHEQLSRQHEAQLHEHIKQQQELLA
MKHQQELLEHQRKLERHRQEQELEKQHREQKLQQLKNKEKGKESAVASTEVKMKLQEFVL
NKKKALAHRNLNHCMSSDPRYWYGKTQHSSLDQSSPPQSGASASYNHPVLGMYDAKDDFP
LRKTASEPNLKLRSRLKQKVAERRSSPLLRRKDGPVVTALKKRPLDVTDSACSSAPGSAP
SSPNNSSGNVSTENGIAPTVPSIPAETSLAHRLVAREGSVGPLPLYTSPSLPNITLGLPA
TGPSTGAAGQQEAERLALPALQQRVSLFPGAHLAPYLGTAPLERDTGAAPGSLLQHVVLL
EQPPAQTPLVTDRYLAGLGALPLHAQPLVGAERVAPSVHKLRQHRPLGRTQSAPLPQSAQ
ALQHLVIQQQHQQFLEKHKQHFQQPQLHLNKMIPKPSEPARQPESHPEETEEELREHQAL
LEEPFLDRLPGQKEAHALAGVQVKQEPIESDDEETEPAREADPGQRLPTEQELLFRQQAL
LLEQQRIHQLRNYQASMEAAGIPVSFGGHRPLSRAQSSPASATFPMSVQEPPAKPRFTTG
LVYDTLMLKHQCTCGNTNSHPEHAGRIQSIWSRLQETGLRSKCECIRGRKATLEELQTVH
SETHALLYGTNPLNRQKLDSKKLLGSLTSVFVRLPCGGVGVDSDTIWNEVHSSGAARLAV
GCVVELVFKVATGELKNGFAVVRPPGHHAEESTPMGFCYFNSVAIAAKLLQQRLSVSKTL
VVDWDVHHGNGTQQAFYSDPRVLYISLHRYDDGNFFPGSGAPDEVGTGAGVGFNVNMAFT
GGLDPPMGDAEYLAAFRTVVMPIASEFAPDVVLVSSGFDAVEGHPTPLGGYNLSAKCFGY
LTKQLMGLAGGRVVLALEGGHDLTAICDASEACVSALLGNELDPLPEKVLQQRPNANAVR
SMEKVIEIHSQYWRSLQRLASTAGYSLVEAQKCENEEAETVTAMASLSVAVKAPEKRPDE
EPMEEEPPL
NT seq 3270 nt NT seq  +upstreamnt  +downstreamnt
atgagctcgcaaagccatccagatggactttctggccgagaccagccagtggagctgctc
aaccctgcccgtgtgaaccacatgcccagcaccgtggacgtggcctcggccctgcctctg
ccggtggcccccccgggggtgcccatggacctgcgcctggaccaccagttcccgctgccc
gtggcggagccgggcctccgcgagcagcagctgcagcaggagctcctggcgctcaagcag
aagcagcagctgcagagacagatcctcatcgccgagttccagcggcagcacgagcagctg
tcgcggcagcacgaggcccagctgcacgagcacatcaagcaacagcaggagctgctggcc
atgaagcaccagcaggagctgctcgagcaccagcggaagctggagcggcatcggcaggag
caggagctggagaagcagcaccgggagcagaagctgcagcagctgaagaacaaggagaag
ggcaaagagagcgccgtggccagcacggaagtgaagatgaagctgcaggagtttgtcctc
aataagaagaaggccctggctcatcggaacctgaaccactgcatgtccagcgaccctcgc
tactggtacgggaagacgcagcacagctcactggaccagagctccccgccccagagcggg
gcgtcggcctcctacaaccacccggtcctgggcatgtacgacgccaaagacgacttcccc
ctcagaaagacagcttctgaacccaacctgaaattgcgctccaggctaaagcagaaagtg
gctgagagacggagcagccccctgctgcgcaggaaagatgggccagtggtcacggctctg
aaaaagcgccccttggatgtcacagactcggcgtgcagcagtgccccaggctccgcgccc
agctcgcccaacaacagctccgggaacgtgagcaccgagaacgggatcgcgcccaccgtc
cccagcatcccggccgagaccagcctggcgcacagactcgtggcgcgagagggctcggtg
ggcccgctgcccctctacacctcaccatccctgcccaacatcacgctggggctgcccgcc
accggcccctccacgggggcagccggccagcaggaggccgagagactggccctccccgcc
ctgcagcagcgcgtctccctcttccccggcgcccacctcgccccctacctgggcacggcg
cccctggagcgtgacacaggggcggcccctggctccctgctgcagcacgtggtcctcctg
gagcagccgcctgcacagacgcccctcgtcacagaccgctatcttgcaggcctgggcgcg
ctgcccctgcacgcgcagcccctggtaggggctgagcgcgtggcaccctcggtgcacaag
ctgcggcagcaccgcccgctgggccgcacgcagtcggcgccgctgcctcagagcgcgcag
gcgctgcagcacctggtcatccagcagcagcaccagcagttcctggagaaacacaagcag
cacttccagcagccgcagctgcacctcaacaagatgatccccaaacccagcgagccagca
cggcagcccgagagccaccccgaggagacggaggaggagttgcgggagcaccaggcactc
ctggaggagcccttcctggaccggctcccggggcagaaggaggcccacgcgctggctggg
gtgcaggtgaagcaggagcccatcgagagtgatgacgaggagacggagcccgcacgggag
gcggaccccggccagcggctgcccacggagcaggagctgctcttcagacagcaagccctc
ctcctggagcagcagcggatccaccagctgaggaactaccaggcatccatggaggccgct
ggcatccccgtgtccttcggcgggcaccggcccctatcccgggcgcagtcctcccccgcg
tctgccaccttccctatgtccgtgcaggagcccccagccaagccgaggtttaccacaggc
ctcgtgtacgacacgctgatgctgaagcaccagtgcacctgcgggaacaccaacagccac
ccagagcacgccgggcgcatccagagcatctggtcgcggctgcaggagaccggcctgcga
agcaaatgtgagtgcatccgtggacggaaggccacgctggaggagctgcagacagtgcac
tcggagacgcacgccctgctctacggcacgaaccccctcaacaggcagaaactggacagt
aagaaacttctaggctcattaacgtccgtgttcgtcaggctgccctgcggtggtgtcggg
gtggacagtgataccatatggaatgaggtgcactcgtcgggggctgcccgcctggctgtg
ggctgtgtggtggagctggtcttcaaggtggccacaggggagctgaagaacggctttgct
gtggtccgccctccaggacaccacgcagaggagagcacgcccatggggttctgctacttc
aactccgtggccatcgctgccaagcttctccagcaaaggctgagcgtgagcaagaccctc
gtggtagactgggacgtgcaccacgggaacgggacccagcaggccttctacagcgacccc
cgcgtgctctacatctccctgcaccgctacgacgacggcaacttcttcccaggcagcggc
gcacccgacgaggtgggcacgggcgctggcgtgggcttcaacgtcaacatggctttcacc
ggcggcctggacccccccatgggagacgcagagtacctggcggccttcaggactgtggtc
atgccgatcgccagcgagtttgccccagatgtggtgctggtgtcctcgggcttcgatgct
gtggagggccaccccacgcccctcggaggctacaacctctccgccaaatgtttcgggtac
ctgacgaagcagctaatgggcctggccggtggccgggttgtcctggcgctagaggggggc
cacgatctcacagccatctgcgacgcctcggaagcctgcgtctctgctctgctggggaat
gagctcgatcctctcccagaaaaggtcttacagcagagacccaacgccaacgccgtgcgg
tcgatggagaaggtcattgaaatccacagccagtactggcgctccctgcagcggctcgcc
tccaccgccggctactccctggtcgaggcccagaagtgtgagaacgaggaagccgagact
gtcactgccatggcctcgctgtctgtggccgtgaaggcccctgagaagagacccgacgag
gagcccatggaagaggagccgcctctgtag

DBGET integrated database retrieval system