KEGG   Capra hircus (goat): 102188148Help
Entry
102188148         CDS       T02910                                 

Gene name
PLCB1
Definition
(RefSeq) phospholipase C beta 1
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
chx  Capra hircus (goat)
Pathway
chx00562  Inositol phosphate metabolism
chx01100  Metabolic pathways
chx04015  Rap1 signaling pathway
chx04020  Calcium signaling pathway
chx04022  cGMP-PKG signaling pathway
chx04062  Chemokine signaling pathway
chx04070  Phosphatidylinositol signaling system
chx04071  Sphingolipid signaling pathway
chx04072  Phospholipase D signaling pathway
chx04261  Adrenergic signaling in cardiomyocytes
chx04270  Vascular smooth muscle contraction
chx04310  Wnt signaling pathway
chx04371  Apelin signaling pathway
chx04540  Gap junction
chx04611  Platelet activation
chx04621  NOD-like receptor signaling pathway
chx04713  Circadian entrainment
chx04720  Long-term potentiation
chx04723  Retrograde endocannabinoid signaling
chx04724  Glutamatergic synapse
chx04725  Cholinergic synapse
chx04726  Serotonergic synapse
chx04728  Dopaminergic synapse
chx04730  Long-term depression
chx04750  Inflammatory mediator regulation of TRP channels
chx04911  Insulin secretion
chx04912  GnRH signaling pathway
chx04915  Estrogen signaling pathway
chx04916  Melanogenesis
chx04918  Thyroid hormone synthesis
chx04919  Thyroid hormone signaling pathway
chx04921  Oxytocin signaling pathway
chx04922  Glucagon signaling pathway
chx04924  Renin secretion
chx04925  Aldosterone synthesis and secretion
chx04926  Relaxin signaling pathway
chx04927  Cortisol synthesis and secretion
chx04928  Parathyroid hormone synthesis, secretion and action
chx04929  GnRH secretion
chx04933  AGE-RAGE signaling pathway in diabetic complications
chx04934  Cushing syndrome
chx04961  Endocrine and other factor-regulated calcium reabsorption
chx04970  Salivary secretion
chx04971  Gastric acid secretion
chx04972  Pancreatic secretion
chx04973  Carbohydrate digestion and absorption
chx05010  Alzheimer disease
chx05016  Huntington disease
chx05142  Chagas disease (American trypanosomiasis)
chx05143  African trypanosomiasis
chx05146  Amoebiasis
chx05163  Human cytomegalovirus infection
chx05200  Pathways in cancer
Module
chx_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:chx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102188148 (PLCB1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102188148 (PLCB1)
   04310 Wnt signaling pathway
    102188148 (PLCB1)
   04371 Apelin signaling pathway
    102188148 (PLCB1)
   04020 Calcium signaling pathway
    102188148 (PLCB1)
   04070 Phosphatidylinositol signaling system
    102188148 (PLCB1)
   04072 Phospholipase D signaling pathway
    102188148 (PLCB1)
   04071 Sphingolipid signaling pathway
    102188148 (PLCB1)
   04022 cGMP-PKG signaling pathway
    102188148 (PLCB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102188148 (PLCB1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102188148 (PLCB1)
   04621 NOD-like receptor signaling pathway
    102188148 (PLCB1)
   04062 Chemokine signaling pathway
    102188148 (PLCB1)
  09152 Endocrine system
   04911 Insulin secretion
    102188148 (PLCB1)
   04922 Glucagon signaling pathway
    102188148 (PLCB1)
   04929 GnRH secretion
    102188148 (PLCB1)
   04912 GnRH signaling pathway
    102188148 (PLCB1)
   04915 Estrogen signaling pathway
    102188148 (PLCB1)
   04921 Oxytocin signaling pathway
    102188148 (PLCB1)
   04926 Relaxin signaling pathway
    102188148 (PLCB1)
   04918 Thyroid hormone synthesis
    102188148 (PLCB1)
   04919 Thyroid hormone signaling pathway
    102188148 (PLCB1)
   04928 Parathyroid hormone synthesis, secretion and action
    102188148 (PLCB1)
   04916 Melanogenesis
    102188148 (PLCB1)
   04924 Renin secretion
    102188148 (PLCB1)
   04925 Aldosterone synthesis and secretion
    102188148 (PLCB1)
   04927 Cortisol synthesis and secretion
    102188148 (PLCB1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102188148 (PLCB1)
   04270 Vascular smooth muscle contraction
    102188148 (PLCB1)
  09154 Digestive system
   04970 Salivary secretion
    102188148 (PLCB1)
   04971 Gastric acid secretion
    102188148 (PLCB1)
   04972 Pancreatic secretion
    102188148 (PLCB1)
   04973 Carbohydrate digestion and absorption
    102188148 (PLCB1)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    102188148 (PLCB1)
  09156 Nervous system
   04724 Glutamatergic synapse
    102188148 (PLCB1)
   04725 Cholinergic synapse
    102188148 (PLCB1)
   04728 Dopaminergic synapse
    102188148 (PLCB1)
   04726 Serotonergic synapse
    102188148 (PLCB1)
   04720 Long-term potentiation
    102188148 (PLCB1)
   04730 Long-term depression
    102188148 (PLCB1)
   04723 Retrograde endocannabinoid signaling
    102188148 (PLCB1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102188148 (PLCB1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102188148 (PLCB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102188148 (PLCB1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102188148 (PLCB1)
   05016 Huntington disease
    102188148 (PLCB1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102188148 (PLCB1)
   04934 Cushing syndrome
    102188148 (PLCB1)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    102188148 (PLCB1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102188148 (PLCB1)
   05142 Chagas disease (American trypanosomiasis)
    102188148 (PLCB1)
   05143 African trypanosomiasis
    102188148 (PLCB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:chx04131]
    102188148 (PLCB1)
Enzymes [BR:chx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     102188148 (PLCB1)
Membrane trafficking [BR:chx04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    102188148 (PLCB1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    102188148 (PLCB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X PLC-beta_C PH_14 PI-PLC-Y EF-hand_like DUF1154
Motif
Other DBs
NCBI-GeneID: 102188148
NCBI-ProteinID: XP_017912397
LinkDB All DBs
Position
13
AA seq 1216 aa AA seqDB search
MAGAQPGVHALQLKPVCVSDSLKKGTKFVKWEDDSTIVTPIILRTDPQGFFFYWTDQNKE
TELLDLSLVKDARCGKHAKAPKDPKLRELLDVGNIGRLEHRMITVVYGPDLVNISHLNLV
AFQEEVAKEWTNEVFSLATNLLAQNMSRDAFLEKAYTKLKLQVTPEGRIPLKNIYRLFSA
DRKRVETALEACSLPSSRNDSIPQEDFTPEVYRVFLNNLCPRPEIDNIFSEFGAKSKPYL
TVDQMMDFINLKQRDPRLNEILYPPLKQEQVQVLIEKYEPNNSLAKKGQISVDGFMRYLS
GEENGVVSPEKLDLNEDMSQPLSHYFINSSHNTYLTAGQLAGNSSVEMYRQVLLSGCRCV
ELDCWKGRTAEEEPVITHGFTMTTEISFKEVIEAIAECAFKTSPFPILLSFENHVDSPKQ
QAKMAEYCRLIFGDALLMEPLDKYPLESGVPLPSPMDLMYKILVKNKKKSHKSAEGGGKK
KLSEQASNTYSDSSSVFEPSSPGAGEADTESDDDDDDDDCKKSSMDEGTAGSEAMATEEM
SNLVNYIQPVKFESFEISKKRNRSFEMSSFVETKGLEQLTKSPVEFVEYNKMQLSRIYPK
GTRVDSSNYMPQLFWNAGCQMVALNFQTVDLAMQINMGMYEYNGKSGYRLKPEFMRRPDK
HFDPFTEGIVDGIVANTLSVKIISGQFLSDKKVGTYVEVDMFGLPVDTRRKALKTKTSQG
NAVNPIWEEEPIVFKKVVLPSLACLRIAVYEEGGKFIGHRILPVQAIRPGYHYICLRNER
NQPLMLPALFVYIEVKDYVPDTYADVIEALSNPIRYVNLMEQRAKQLAALTLEDEEEVKK
EADPGEAPSEAPSEARPTPAENGVNHTTSLTPKPPSQALHSQPAPGSVKAPAKTEDLIQS
VLTEVEAQTIEELKQQKSFVKLQKKHYKEMKDLVKRHHKKTTDLIKEHTTKYNEIQNDYL
RRRAALEKTAKKDNKKKSEPSSPDHVSSTIEQDLAALDAEMTQKLVDLKDKQQQQLLNLR
QEQYYSEKYQKREHIKLLIQKLTDVAEECQNNQLKKLKEICEKEKKELKKKMDKKRQEKI
TEAKSKDKSQMEEEKTEMIRSYIQEVVQYIKRLEEAQSKRQEKLVEKHKEIRQQILDEKP
KLQVELEQEYQDKFKRLPLEILEFVQEAMKGKISEDSNHSSAPPLMTSDSGKLNQKLPSS
EELEGENPGKEFDTPL
NT seq 3651 nt NT seq  +upstreamnt  +downstreamnt
atggccggggcacagcctggagtgcacgcgctgcaactcaagccggtgtgcgtgtcggac
agcctcaagaagggcaccaaattcgtcaagtgggaggatgactccactattgtcactccg
attattttgaggactgaccctcagggatttttcttttactggacagatcaaaacaaggag
acggaactgttagatctcagccttgtcaaagacgccagatgtgggaagcatgccaaggcg
cccaaggaccctaaattacgtgaacttctggatgtggggaacattgggcgcctggaacat
cgcatgataacagtagtgtatgggcctgacttagtgaacatctcccacttgaacctcgtg
gctttccaagaagaagtggccaaggaatggacaaatgaggttttcagtttggcaacaaac
ctgctggcccaaaacatgtccagggacgcatttctggaaaaggcgtatactaaacttaag
ctgcaagtcactccagaaggacgcattcctctgaaaaacatataccgcctgttctcagca
gaccggaagcgagtcgagacagctttagaggcttgtagtcttccatcttcaaggaatgat
tcgatacctcaagaagatttcactcctgaagtgtacagagttttcctgaacaacctttgt
cctcgacctgaaattgataacatcttttctgaatttggtgccaaaagcaaaccatacctt
acagttgatcagatgatggattttatcaacctcaagcagcgagatccccggctaaatgaa
atactttacccacctttaaagcaagagcaagtccaagtgttgattgagaagtatgaacct
aacaacagcctcgccaaaaaaggacagatatcagtggatggatttatgcgctatctgagt
ggagaagaaaatggagtcgtttcacctgagaaactggatttgaatgaagatatgtctcag
cccctttctcactatttcattaattcctcacacaacacctacctcacagctggccagctg
gctggaaactcctctgtcgagatgtatcgccaagtgctcctgtctggttgtcgctgtgtg
gagctggactgctggaagggacggactgcagaagaggagccagtcatcacccatgggttc
accatgaccacagaaatatccttcaaggaagtgatcgaagccattgctgagtgtgcattt
aagacttcaccttttccaattctgctttcatttgagaaccatgtggactcgccgaagcag
caggccaagatggcggagtactgcagactcatcttcggcgacgccctcctcatggagccg
ctggacaagtacccgttggaatctggagttccccttccaagtcctatggatttgatgtac
aaaattttggtgaaaaataagaagaaatcacacaagtcagcagaaggaggtggcaagaag
aagctctcagaacaagcttccaacacgtacagcgactcctccagtgtgtttgagccctcg
tccccaggagccggagaagctgatacagagagtgacgatgatgacgatgatgatgactgt
aaaaagtcttccatggatgaggggaccgcagggagcgaggccatggctacagaagagatg
tctaatctggtgaactatatccagccagtcaagttcgagtcatttgaaatttcaaaaaaa
agaaatagaagcttcgagatgtcttcctttgtggaaaccaaaggtcttgagcaacttaca
aagtctccggtggaatttgtagaatataacaaaatgcagcttagcaggatatatccaaag
ggaacacgcgtggattcatctaactatatgcctcagcttttctggaatgcaggctgccaa
atggttgcccttaatttccaaacagtggacctggctatgcagataaacatggggatgtat
gaatacaatgggaagagtggctacaggctgaagccggagttcatgaggagacctgacaag
cactttgatccattcacagaaggcatcgtggatggcatagtggccaacactttatctgtt
aagattatttcaggtcagtttctctctgataagaaagtcgggacttacgtggaagtggat
atgtttggtttgcctgtggacacaaggaggaaggcattgaagaccaaaacatcacaagga
aacgctgtaaatcccatctgggaagaagaacccattgtattcaaaaaggtggttcttcct
tcgctagcctgtctgaggatagcagtttatgaagaaggaggtaaatttattggtcaccga
atcttgccagtacaagcaattcggccaggctatcactacatctgtctgaggaacgagagg
aaccagcctctgatgctgccagccctctttgtctacatagaggtgaaggactatgtccca
gacacatatgcagacgtgattgaagctttgtcaaatccaatccgatatgtgaatctgatg
gagcagagagctaaacaactggctgctttgaccctggaagatgaagaagaagtgaagaaa
gaggctgatcctggggaagcaccatcagaagctccgagtgaagccaggccaactccagca
gaaaacggggtgaatcacacgacgtccctgacacccaaaccaccctcccaggctctgcac
agccaaccggctccaggttctgtaaaggcacctgccaaaacagaagatcttattcagagt
gttttaacagaagtagaagcgcagacgattgaagagctaaagcagcagaagtcgtttgtg
aaacttcaaaagaagcactacaaggaaatgaaagacctggttaagagacaccacaagaaa
accaccgacctcatcaaagagcacactacaaaatacaatgaaatccagaacgactacttg
agaaggagagcagctctggaaaagacagccaaaaaggacaataagaaaaaatcagaaccc
agtagccctgaccacgtctcatcaacaattgaacaagaccttgctgccctggatgccgaa
atgacccaaaagttagtagatctgaaggacaaacagcagcagcagctgcttaatcttcga
caagagcagtattatagcgaaaaataccagaagcgagaacacattaaactgcttattcaa
aaattgactgatgttgctgaagaatgtcagaataatcagttaaagaagctcaaagaaatc
tgtgagaaagagaagaaggaattaaagaagaaaatggataaaaagaggcaggagaagata
acagaagctaaatccaaagacaaaagccagatggaggaggaaaagacggagatgatccgg
tcatacatccaggaggtggtgcagtacatcaagaggttagaagaggcacaaagtaaacgg
caagaaaaactcgtggagaaacacaaagaaatccgccagcagatcctggatgaaaagccc
aagctacaggtggaactggagcaagaataccaagacaagttcaaaaggctgcccctggag
attttggaattcgtgcaggaagccatgaaagggaagattagtgaagacagcaatcacagc
tctgcccctcccctgatgacctcagactctggaaaactaaaccagaagcttccttccagt
gaagaattggaaggagaaaacccaggaaaagagtttgatacccctctgtga

DBGET integrated database retrieval system