KEGG   Capra hircus (goat): 102188253Help
Entry
102188253         CDS       T02910                                 

Gene name
TK1
Definition
(RefSeq) thymidine kinase 1
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
chx  Capra hircus (goat)
Pathway
chx00240  Pyrimidine metabolism
chx00983  Drug metabolism - other enzymes
chx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:chx00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    102188253 (TK1)
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    102188253 (TK1)
Enzymes [BR:chx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     102188253 (TK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TK AAA_14 ATPase_2
Motif
Other DBs
NCBI-GeneID: 102188253
NCBI-ProteinID: XP_017919175
LinkDB All DBs
Position
19
AA seq 238 aa AA seqDB search
MSCINLPNVLPGSPSKTRGQIQVILGPMFSGKSTELMRRVRRFQIAQYKCLVIKYARDTR
YSSLFSTHDRNTMEALPACLLRDVIQDAQGVAVIGIDEGQFFPDIVEFCENMANSGKTVI
VAALDGTFQRKAFGTILNLVPLAESVVKLTAVCMECFREAAYTKRLGVEKEVEVIGGADK
YHSVCRLCYFKKPSGQPAVLDSEENKENCPMTLGKPAEAAGVRKLFATHQIRQCSQAN
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgagctgcatcaatctgcccaatgtgctgccaggctcccccagcaagacccggggccag
atccaggtgattctcggacccatgttctcaggaaaaagtactgagctgatgagacgggtc
cgtcgcttccagattgcccagtacaagtgcctggtgatcaaatatgccagagacacgcgt
tacagcagcctcttctccacccatgaccggaacaccatggaggccctgccagcctgtctg
ctccgggacgtgatccaggatgcccagggcgtggctgtcataggcatcgacgaagggcag
tttttccctgacattgtggagttctgcgagaacatggccaactcggggaagaccgtcatc
gtggctgcgctggatgggacctttcagaggaaggcttttgggaccatcctgaacctggtg
cccctggcagagagcgtggtcaagctgacggcggtgtgcatggagtgcttccgagaggcc
gcctacaccaagaggctgggcgtggaaaaggaggtcgaggtcattggaggagcagacaag
taccactccgtgtgccgcctgtgctacttcaagaagccctcgggtcagcccgccgtgctg
gacagcgaagaaaataaggagaactgcccgatgacgctgggaaagcccgcggaggccgcg
ggagtccggaagctgtttgccactcatcagatccggcagtgcagccaggccaactga

DBGET integrated database retrieval system