KEGG   Capra hircus (goat): 102188638
Entry
102188638         CDS       T02910                                 

Gene name
CDC42
Definition
(RefSeq) cell division cycle 42
  KO
K04393  cell division control protein 42
Organism
chx  Capra hircus (goat)
Pathway
chx04010  MAPK signaling pathway
chx04014  Ras signaling pathway
chx04015  Rap1 signaling pathway
chx04062  Chemokine signaling pathway
chx04144  Endocytosis
chx04360  Axon guidance
chx04370  VEGF signaling pathway
chx04510  Focal adhesion
chx04520  Adherens junction
chx04530  Tight junction
chx04660  T cell receptor signaling pathway
chx04666  Fc gamma R-mediated phagocytosis
chx04670  Leukocyte transendothelial migration
chx04722  Neurotrophin signaling pathway
chx04810  Regulation of actin cytoskeleton
chx04912  GnRH signaling pathway
chx04932  Non-alcoholic fatty liver disease
chx04933  AGE-RAGE signaling pathway in diabetic complications
chx05100  Bacterial invasion of epithelial cells
chx05132  Salmonella infection
chx05135  Yersinia infection
chx05165  Human papillomavirus infection
chx05200  Pathways in cancer
chx05203  Viral carcinogenesis
chx05205  Proteoglycans in cancer
chx05211  Renal cell carcinoma
chx05212  Pancreatic cancer
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102188638 (CDC42)
   04014 Ras signaling pathway
    102188638 (CDC42)
   04015 Rap1 signaling pathway
    102188638 (CDC42)
   04370 VEGF signaling pathway
    102188638 (CDC42)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102188638 (CDC42)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102188638 (CDC42)
   04520 Adherens junction
    102188638 (CDC42)
   04530 Tight junction
    102188638 (CDC42)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102188638 (CDC42)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    102188638 (CDC42)
   04666 Fc gamma R-mediated phagocytosis
    102188638 (CDC42)
   04670 Leukocyte transendothelial migration
    102188638 (CDC42)
   04062 Chemokine signaling pathway
    102188638 (CDC42)
  09152 Endocrine system
   04912 GnRH signaling pathway
    102188638 (CDC42)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102188638 (CDC42)
  09158 Development and regeneration
   04360 Axon guidance
    102188638 (CDC42)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102188638 (CDC42)
   05205 Proteoglycans in cancer
    102188638 (CDC42)
   05203 Viral carcinogenesis
    102188638 (CDC42)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102188638 (CDC42)
   05211 Renal cell carcinoma
    102188638 (CDC42)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    102188638 (CDC42)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102188638 (CDC42)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102188638 (CDC42)
   05135 Yersinia infection
    102188638 (CDC42)
   05100 Bacterial invasion of epithelial cells
    102188638 (CDC42)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    102188638 (CDC42)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:chx04131]
    102188638 (CDC42)
   03036 Chromosome and associated proteins [BR:chx03036]
    102188638 (CDC42)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:chx04147]
    102188638 (CDC42)
   04031 GTP-binding proteins [BR:chx04031]
    102188638 (CDC42)
Membrane trafficking [BR:chx04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    102188638 (CDC42)
 Endocytosis
  Lipid raft mediated endocytosis
   GRAF1-dependent endocytosis
    102188638 (CDC42)
  Macropinocytosis
   Ras GTPases
    102188638 (CDC42)
Chromosome and associated proteins [BR:chx03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    102188638 (CDC42)
Exosome [BR:chx04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   102188638 (CDC42)
  Exosomal proteins of breast milk
   102188638 (CDC42)
GTP-binding proteins [BR:chx04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    102188638 (CDC42)
SSDB
Motif
Pfam: Ras Roc Arf PET117 GTP_EFTU
Other DBs
NCBI-GeneID: 102188638
NCBI-ProteinID: XP_017910846
LinkDB
Position
2
AA seq 191 aa
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG
QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLR
DDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPP
EPKKSRRCVLL
NT seq 576 nt   +upstreamnt  +downstreamnt
atgcagacaattaagtgcgttgttgtgggtgatggtgctgttggtaaaacgtgtctcctg
atatcctacacaaccaacaaatttccatctgagtatgtaccaactgtttttgacaactat
gctgtcacagttatgattggtggagagccatatactcttggactttttgatactgcaggg
caggaggactatgacaggttgcgaccgctgagctatccacagacagacgtgtttctggtc
tgcttctcagtggtctctccatcctcattcgaaaatgtgaaagagaagtgggtgcctgag
ataactcaccactgtccaaagactcctttcttgcttgttgggacccaaattgatctcaga
gatgacccctctactattgagaaacttgctaagaataagcagaagcctatcactccagag
actgctgaaaagctggcccgtgacctgaaggctgtcaagtatgtggagtgctctgcactc
acacagaaaggcctaaagaatgtatttgatgaagcaatattggctgccctggagcctcca
gaaccgaagaagagccgcaggtgtgtgctgctatga

DBGET integrated database retrieval system