KEGG   Capra hircus (goat): 102188830
Entry
102188830         CDS       T02910                                 

Gene name
APAF1, Apaf-1
Definition
(RefSeq) apoptotic peptidase activating factor 1
  KO
K02084  apoptotic protease-activating factor
Organism
chx  Capra hircus (goat)
Pathway
chx01524  Platinum drug resistance
chx04115  p53 signaling pathway
chx04210  Apoptosis
chx04215  Apoptosis - multiple species
chx05010  Alzheimer disease
chx05012  Parkinson disease
chx05014  Amyotrophic lateral sclerosis
chx05016  Huntington disease
chx05020  Prion disease
chx05022  Pathways of neurodegeneration - multiple diseases
chx05134  Legionellosis
chx05152  Tuberculosis
chx05160  Hepatitis C
chx05161  Hepatitis B
chx05162  Measles
chx05164  Influenza A
chx05168  Herpes simplex virus 1 infection
chx05169  Epstein-Barr virus infection
chx05200  Pathways in cancer
chx05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:chx00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102188830 (APAF1)
   04215 Apoptosis - multiple species
    102188830 (APAF1)
   04115 p53 signaling pathway
    102188830 (APAF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102188830 (APAF1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    102188830 (APAF1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102188830 (APAF1)
   05012 Parkinson disease
    102188830 (APAF1)
   05014 Amyotrophic lateral sclerosis
    102188830 (APAF1)
   05016 Huntington disease
    102188830 (APAF1)
   05020 Prion disease
    102188830 (APAF1)
   05022 Pathways of neurodegeneration - multiple diseases
    102188830 (APAF1)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    102188830 (APAF1)
   05152 Tuberculosis
    102188830 (APAF1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    102188830 (APAF1)
   05160 Hepatitis C
    102188830 (APAF1)
   05164 Influenza A
    102188830 (APAF1)
   05162 Measles
    102188830 (APAF1)
   05168 Herpes simplex virus 1 infection
    102188830 (APAF1)
   05169 Epstein-Barr virus infection
    102188830 (APAF1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102188830 (APAF1)
SSDB
Motif
Pfam: NB-ARC WD40 APAF1_C ANAPC4_WD40 CARD Ge1_WD40 WD40_like CARD_2 AAA_16 Hira ATPase_2 AAA_22 NACHT
Other DBs
NCBI-GeneID: 102188830
NCBI-ProteinID: NP_001301104
UniProt: A0A0F6QJN8
LinkDB
Position
5
AA seq 1249 aa
MDAKARNCLLQHREALERDIKTSYIMDHMISNGVLTVSEEEKVKNEPTQRQRAAMLIKMI
LKKDNHSYISFYNALLHEGYRDLAALLHGGIPVVSSSDGKDSVSGITSYVRTVLCEGGVP
QRPVVFVTRKKLVNAIQQKLSKLNGEPGWVTIYGMAGCGKSVLAAEAVRDHSFLEDCFPG
GVHWVSVGKQDKSGLLMKLQNLCARLDQDESFSQRLPLNIEEAKDRLRILMLRKHPRSLL
ILDDIWDPWVLKAFDNQCRILLTTRDKSVTDSVMGPKYVVPVESGLGKEKALEILSLFVN
MKKADLPEQAHSIIQECKGSPLVVSLIGALLRDFPNRWEYYLRQLQNKQFKRIRKSSSYD
YEALDEAMSISVEMLREDIKDYYTDLSIVQKDVKVPTKVLCILWDLETEEVEDILQEFVN
KSLLFCDRNGKSFLYYLHDLQVDFLTEKNRSQLQDLHKKMVTQFQRHHQLYSLTPDQEDC
MYWYNFLAYHMASANMHKELCALMFSLDWIKAKTELVGPAHLIHEFVEYRHILDEKDGTD
CENFQEFLSLNGHLLGRQPFPNIVQLGLCELETSEVYRQAKLQAKQEVDNGMLYLEWVNK
KNMKNLSRLVVRPHTDAVYHACFSEDGQRIASCGADKTLQVFKAETGEKLLEIKAHEDEV
LCCAFSADDRFIATCSVDKKVKIWNSMTGELVRIYDEHSEQVNCCHFTNNSSHLLLATGS
NDYFLKLWDLNQEECRNTMFGHTNSVSHCRFSPDDQVLASCSADGTLKLWDVKSANERKS
INVKQFFLNSEEPQEDLEVIVKCCSWSADGAKIMVAAKNKVFLFDIHTSGLLAEIHMGHH
STVQYCDFSPHNHLAVVALSQYCVELWSMDSGLKVADCRGHLSWVHCVMFSPDGSSFLTS
SDDQTVRLWETKKVCKNSATVLKQEIDVVFQEKEVTVLAVDNIRRLQLINGNTGQIDYLT
EAQVSCCCLSPHLQYLAFGAEDGAIQILELLNNRIFQSRNAHKTTVRHIQFTADGKTLIS
SSDDSAIQIWNWQSEDPFFLQAHQETVKDFKLLKNSRLLSWSFDGTVKVWNITTRRIEKD
FVCHQDTVLSCDISSDGAKFSSTSADKTAKIWSFELLSPLHELRGHKGCVRCSSFSVDNT
MLATGDDNGEIRMWNVSNGELLHLCAPISVEEGAATHGGWVTDLCFSPDNKMLVSAGGYL
KWWNVVTGESSQTFYTNGTNLKKIHVSPDFKTYVTVDNLGILYILKILE
NT seq 3750 nt   +upstreamnt  +downstreamnt
atggatgcaaaagctcgaaattgtttgcttcaacatcgagaagccttggaaagggacatc
aaaacatcctacatcatggatcacatgattagtaatggcgttttaacagtgtcagaggag
gaaaaagtgaaaaatgagcccacccaacggcaacgagcagctatgctaattaaaatgata
cttaaaaaagataatcattcctatatatcattctacaatgctctacttcatgaaggttac
agagatcttgctgccctgctgcatggtggcattcctgtcgtctcttcttccgatggcaaa
gattcagttagtggaataacttcatatgtaaggacagtcctgtgtgaaggtggagtacca
cagaggcccgttgtttttgttactaggaagaagctagtgaatgcaattcagcagaagctc
tccaaactgaatggtgaaccgggatgggtcaccatatatggaatggcaggttgtgggaaa
tctgtattagctgcagaagctgttcgagatcattctttcctagaagattgtttcccaggg
ggcgtgcattgggtgtcagttgggaaacaggacaaatctgggcttctgatgaagctacag
aacctttgcgcacgattggatcaggatgaaagcttctcccagaggcttccacttaatatt
gaagaggctaaagatcgtctccgcattctgatgctgcgcaaacatccaaggtctttattg
atcttggatgatatttgggatccttgggtgttaaaagcttttgacaatcagtgtcgaatt
cttctcacaaccagagataagagtgttacagattcagtaatgggtcctaaatatgtagtg
cctgtggagagtggtttaggaaaagaaaaagcacttgaaattttatccctttttgttaat
atgaagaaagcagatttgccagaacaagctcacagtattatacaagaatgtaaaggttcc
cctcttgtagtgtctttaattggtgcacttttacgagattttcccaaccgctgggagtac
tacctcaggcaacttcagaataagcaatttaagaggataagaaaatcttcatcttatgac
tatgaggctctagatgaagccatgtctataagtgttgaaatgctcagagaagacatcaaa
gattattacacagatctttccatcgttcagaaagatgttaaggtgcctacaaaggtgtta
tgtatcctctgggacttagaaacggaagaagttgaagacatattacaggaatttgttaat
aagtctctcttgttctgtgaccggaatggaaaatcatttctttattatttacatgatctg
caagtagatttccttactgaaaagaatcgcagccagcttcaggatctccacaagaagatg
gtcactcagttccagagacatcaccagttatattctcttacaccagatcaggaggattgc
atgtattggtacaattttctggcctatcacatggccagtgctaatatgcacaaagaactg
tgtgctttaatgttttccctggattggattaaagcaaaaacagaacttgtaggccctgct
catctgattcatgaatttgtggaatacaggcatatattggatgaaaaggatggtacagac
tgtgagaatttccaggagtttttatctttaaatgggcatcttcttggacgacagccattt
cctaatattgtgcaactgggcctctgtgaactggaaacttcagaggtttatcggcaagct
aagctgcaggccaagcaggaggtcgataacggaatgctttacctggagtgggtaaacaaa
aaaaacatgaagaacctctcccgcttggttgtccgcccccatacagatgctgtttaccat
gcttgcttttctgaagatggtcaaagaatagcttcttgtggagctgataaaactttacag
gtattcaaagctgaaacaggagagaaacttctagaaatcaaggctcatgaggatgaagtg
ctttgctgtgcattctctgcagatgacagatttatagcaacctgctcagtggataaaaaa
gtgaagatttggaattcaatgactggggaactagtgcgtatctatgatgagcactcagag
caagtcaattgctgccacttcaccaacaacagtagtcaccttctcttagccactggttca
aatgactacttccttaaactctgggatctgaatcaagaagaatgtcgaaataccatgttt
ggccatacaaattcagtcagtcactgcagattttcaccagatgatcaggttttggccagt
tgttcagctgatggaacattaaagctttgggatgtgaaatccgcaaatgagaggaaaagc
attaatgtgaagcagttcttcctgaattcagaggagcctcaggaggatctggaagtgata
gtgaaatgctgttcgtggtctgctgatggtgctaagataatggtggccgcgaaaaataaa
gtctttctttttgacattcacaccagtggcctgttggcagaaatccacatgggccatcat
agcactgtccagtactgtgacttctccccccacaaccatttggcagtggtggctttgtcc
cagtactgtgtggagttgtggagtatggactcaggtttaaaagtagctgattgcagagga
catttaagttgggtccattgtgtgatgttttctcctgatggatcatcatttttgacatct
tctgatgaccagacagtcaggctctgggagacaaagaaagtatgtaagaactctgctaca
gtgttaaagcaagagatagatgttgtgtttcaagaaaaggaagtgacggttcttgcagtt
gacaatataagacgtctgcaactcattaatggaaacacaggtcagattgattacctaact
gaagctcaagtgagttgctgttgtttaagtccacatcttcagtaccttgcattcggagct
gaagatggagccattcagattttagaactcctgaacaacagaatcttccaatccaggaat
gcgcacaaaaccactgttcggcacatccagttcacagctgatggaaagactcttatctca
agctctgatgattctgcaattcagatatggaattggcagtcagaggaccctttctttctc
caagcccaccaggaaacagtgaaagactttaaactcttgaaaaattcaagactgctttcc
tggtcatttgatggaacagtaaaggtatggaatattactaccagaagaatagaaaaagat
tttgtgtgtcaccaggatacagttctttcttgtgatatttcctctgatggcgctaagttt
tcttctacctctgctgacaagactgcaaagatttggagttttgaactcctttctcctctt
catgaattgagaggccacaaaggctgtgtgcgctgctcttccttctctgtggacaatacc
atgttggcgactggagacgacaatggagaaatcaggatgtggaatgtctcaaacggtgag
cttcttcatttgtgtgctccaatttcagtagaagaaggagctgctactcatggaggctgg
gtgaccgatctttgcttttctccagacaacaaaatgcttgtttctgctggcggatatctc
aagtggtggaatgttgtcactggggaatcctcacagaccttctacacaaacggaaccaat
cttaagaaaatacatgtgtcccctgacttcaaaacatatgtgactgttgataatcttggt
attttatatattttaaagattttagagtaa

DBGET integrated database retrieval system