KEGG   Capra hircus (goat): 102188850
Entry
102188850         CDS       T02910                                 

Gene name
FGF1
Definition
(RefSeq) fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
chx  Capra hircus (goat)
Pathway
chx04010  MAPK signaling pathway
chx04014  Ras signaling pathway
chx04015  Rap1 signaling pathway
chx04151  PI3K-Akt signaling pathway
chx04390  Hippo signaling pathway
chx04810  Regulation of actin cytoskeleton
chx05200  Pathways in cancer
chx05218  Melanoma
chx05224  Breast cancer
chx05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102188850 (FGF1)
   04014 Ras signaling pathway
    102188850 (FGF1)
   04015 Rap1 signaling pathway
    102188850 (FGF1)
   04390 Hippo signaling pathway
    102188850 (FGF1)
   04151 PI3K-Akt signaling pathway
    102188850 (FGF1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102188850 (FGF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102188850 (FGF1)
  09162 Cancer: specific types
   05226 Gastric cancer
    102188850 (FGF1)
   05218 Melanoma
    102188850 (FGF1)
   05224 Breast cancer
    102188850 (FGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:chx04052]
    102188850 (FGF1)
   00536 Glycosaminoglycan binding proteins [BR:chx00536]
    102188850 (FGF1)
Cytokines and growth factors [BR:chx04052]
 Growth factors
  Growth factors (RTK binding)
   102188850 (FGF1)
Glycosaminoglycan binding proteins [BR:chx00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   102188850 (FGF1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 102188850
NCBI-ProteinID: XP_005683139
UniProt: A0A142I1Y1
LinkDB
Position
7
AA seq 155 aa
MAEGETTTFRALTEKFNLPLGNYKKPKLLYCSNGGYFLRILPDGKVDGTKDRSDQHIQLQ
LYAESIGEVYIKSTETGQFLAMDTNGLLYGSQTPSEECLFLERLEENHYNTYISKKHAEK
NWFIGLKKNGSSKLGPRTHFGQKAILFLPLPVSSD
NT seq 468 nt   +upstreamnt  +downstreamnt
atggctgaaggagaaaccacaaccttcagggccctgactgagaagtttaacctgcctcta
ggcaattacaagaagcccaagctcctctattgcagcaacgggggctacttcctgagaatc
ctcccagatggcaaagtggatgggacgaaggacaggagcgaccagcacattcagctgcag
ctctatgcggaaagcataggggaggtgtatattaagagtacggagactggccagttcttg
gccatggacaccaacgggcttttgtacggctcacagacacccagtgaggaatgtttgttc
ctggaaaggctggaggaaaaccattataacacctacatatccaagaagcatgcagagaag
aattggttcattggtctcaagaagaacggaagctccaaactcggtcctcggactcacttc
ggccagaaagccatcttgtttctccccctgccagtttcctctgattaa

DBGET integrated database retrieval system