KEGG   Capra hircus (goat): 102188874
Entry
102188874         CDS       T02910                                 

Gene name
GNAS
Definition
(RefSeq) guanine nucleotide-binding protein G(s) subunit alpha isoforms short
  KO
K04632  guanine nucleotide-binding protein G(s) subunit alpha
Organism
chx  Capra hircus (goat)
Pathway
chx01522  Endocrine resistance
chx04015  Rap1 signaling pathway
chx04020  Calcium signaling pathway
chx04024  cAMP signaling pathway
chx04072  Phospholipase D signaling pathway
chx04261  Adrenergic signaling in cardiomyocytes
chx04270  Vascular smooth muscle contraction
chx04540  Gap junction
chx04611  Platelet activation
chx04713  Circadian entrainment
chx04714  Thermogenesis
chx04724  Glutamatergic synapse
chx04726  Serotonergic synapse
chx04728  Dopaminergic synapse
chx04730  Long-term depression
chx04750  Inflammatory mediator regulation of TRP channels
chx04911  Insulin secretion
chx04912  GnRH signaling pathway
chx04913  Ovarian steroidogenesis
chx04915  Estrogen signaling pathway
chx04916  Melanogenesis
chx04918  Thyroid hormone synthesis
chx04921  Oxytocin signaling pathway
chx04922  Glucagon signaling pathway
chx04923  Regulation of lipolysis in adipocytes
chx04924  Renin secretion
chx04925  Aldosterone synthesis and secretion
chx04926  Relaxin signaling pathway
chx04927  Cortisol synthesis and secretion
chx04928  Parathyroid hormone synthesis, secretion and action
chx04934  Cushing syndrome
chx04935  Growth hormone synthesis, secretion and action
chx04961  Endocrine and other factor-regulated calcium reabsorption
chx04962  Vasopressin-regulated water reabsorption
chx04970  Salivary secretion
chx04971  Gastric acid secretion
chx04972  Pancreatic secretion
chx04976  Bile secretion
chx05012  Parkinson disease
chx05030  Cocaine addiction
chx05031  Amphetamine addiction
chx05032  Morphine addiction
chx05034  Alcoholism
chx05142  Chagas disease
chx05146  Amoebiasis
chx05163  Human cytomegalovirus infection
chx05165  Human papillomavirus infection
chx05200  Pathways in cancer
chx05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102188874 (GNAS)
   04020 Calcium signaling pathway
    102188874 (GNAS)
   04072 Phospholipase D signaling pathway
    102188874 (GNAS)
   04024 cAMP signaling pathway
    102188874 (GNAS)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102188874 (GNAS)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102188874 (GNAS)
  09152 Endocrine system
   04911 Insulin secretion
    102188874 (GNAS)
   04922 Glucagon signaling pathway
    102188874 (GNAS)
   04923 Regulation of lipolysis in adipocytes
    102188874 (GNAS)
   04912 GnRH signaling pathway
    102188874 (GNAS)
   04913 Ovarian steroidogenesis
    102188874 (GNAS)
   04915 Estrogen signaling pathway
    102188874 (GNAS)
   04921 Oxytocin signaling pathway
    102188874 (GNAS)
   04926 Relaxin signaling pathway
    102188874 (GNAS)
   04935 Growth hormone synthesis, secretion and action
    102188874 (GNAS)
   04918 Thyroid hormone synthesis
    102188874 (GNAS)
   04928 Parathyroid hormone synthesis, secretion and action
    102188874 (GNAS)
   04916 Melanogenesis
    102188874 (GNAS)
   04924 Renin secretion
    102188874 (GNAS)
   04925 Aldosterone synthesis and secretion
    102188874 (GNAS)
   04927 Cortisol synthesis and secretion
    102188874 (GNAS)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102188874 (GNAS)
   04270 Vascular smooth muscle contraction
    102188874 (GNAS)
  09154 Digestive system
   04970 Salivary secretion
    102188874 (GNAS)
   04971 Gastric acid secretion
    102188874 (GNAS)
   04972 Pancreatic secretion
    102188874 (GNAS)
   04976 Bile secretion
    102188874 (GNAS)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    102188874 (GNAS)
   04961 Endocrine and other factor-regulated calcium reabsorption
    102188874 (GNAS)
  09156 Nervous system
   04724 Glutamatergic synapse
    102188874 (GNAS)
   04728 Dopaminergic synapse
    102188874 (GNAS)
   04726 Serotonergic synapse
    102188874 (GNAS)
   04730 Long-term depression
    102188874 (GNAS)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102188874 (GNAS)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102188874 (GNAS)
   04714 Thermogenesis
    102188874 (GNAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102188874 (GNAS)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    102188874 (GNAS)
  09165 Substance dependence
   05030 Cocaine addiction
    102188874 (GNAS)
   05031 Amphetamine addiction
    102188874 (GNAS)
   05032 Morphine addiction
    102188874 (GNAS)
   05034 Alcoholism
    102188874 (GNAS)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    102188874 (GNAS)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102188874 (GNAS)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    102188874 (GNAS)
   05165 Human papillomavirus infection
    102188874 (GNAS)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102188874 (GNAS)
   05142 Chagas disease
    102188874 (GNAS)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102188874 (GNAS)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:chx04147]
    102188874 (GNAS)
   04031 GTP-binding proteins [BR:chx04031]
    102188874 (GNAS)
Exosome [BR:chx04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102188874 (GNAS)
  Exosomal proteins of other body fluids (saliva and urine)
   102188874 (GNAS)
  Exosomal proteins of colorectal cancer cells
   102188874 (GNAS)
  Exosomal proteins of bladder cancer cells
   102188874 (GNAS)
GTP-binding proteins [BR:chx04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 2 (Gs)
    102188874 (GNAS)
SSDB
Motif
Pfam: G-alpha Arf Roc Gtr1_RagA GTP_EFTU AAA_29 TniB
Other DBs
NCBI-GeneID: 102188874
NCBI-ProteinID: XP_017913100
LinkDB
Position
13
AA seq 395 aa
MGCLGNSKTEDQRNEEKAQREANKKIEKQLQKDKQVYRATHRLLLLGAGESGKSTIVKQM
RILHVNGFNGEGGEEDPQAARSNSDGSEKATKVQDIKNNLKEAIETIVAAMSNLVPPVEL
ANPENQFRVDYILSVMNVPDFDFPPEFYEHAKALWEDEGVRACYERSNEYQLIDCAQYFL
DKIDVIKQDDYVPSDQDLLRCRVLTSGIFETKFQVDKVNFHMFDVGGQRDERRKWIQCFN
DVTAIIFVVASSSYNMVIREDNQTNRLQEALNLFKSIWNNRWLRTISVILFLNKQDLLAE
KVLAGKSKIEDYFPEFARYTTPEDATPEPGEDPRVTRAKYFIRDEFLRISTASGDGRHYC
YPHFTCAVDTENIRRVFNDCRDIIQRMHLRQYELL
NT seq 1188 nt   +upstreamnt  +downstreamnt
atgggctgtctcggaaacagcaagaccgaggaccagcgcaacgaggagaaggcgcagcgc
gaggccaacaagaagatcgagaagcagctgcagaaggacaagcaggtctaccgggccacg
caccgtctgctgctgctgggtgctggagaatctggtaaaagcaccattgtgaagcaaatg
aggatcctgcatgttaatgggtttaatggagagggcggcgaagaggacccgcaggctgca
aggagcaacagcgatggtagtgagaaggccaccaaagtgcaggacatcaaaaacaacctg
aaagaggccattgaaaccatcgtggccgccatgagcaacctggtgccccctgtggagctg
gccaacccagagaaccagttcagagtggattacattctgagcgtgatgaacgtgccggac
tttgatttccctcccgaattctatgagcatgccaaggctctctgggaggatgaaggggtg
cgtgcctgctatgagcgctccaatgagtaccagctgattgactgcgcccagtacttcctg
gacaagattgatgtcatcaagcaggatgactacgtgcccagcgaccaggatctgctccgc
tgccgtgtcctgacttctggaatctttgagaccaagttccaggtggacaaagtcaacttc
cacatgtttgacgtgggcggccagcgtgatgaacgccgcaaatggatccaatgcttcaat
gatgtgactgccatcatcttcgtggttgccagcagcagctacaacatggtcattcgggag
gacaaccagaccaaccgcctgcaggaggctctgaacctcttcaagagcatctggaacaac
agatggctgcgcaccatctctgtgattctgttcctcaacaagcaagatctgctggctgag
aaagtccttgctggaaaatcgaagattgaggactactttccagaatttgctcgctacact
actcctgaggatgcgactcccgagcctggagaggacccacgcgtgacccgggccaagtac
ttcattcgagatgaatttctgagaatcagcactgctagtggagatgggcgccactactgc
taccctcacttcacctgcgctgtggacaccgagaacatccgccgtgtgttcaacgactgc
cgtgacatcatccagcgcatgcacctccgtcagtatgagctgctctaa

KEGG   Capra hircus (goat): 108633189
Entry
108633189         CDS       T02910                                 

Definition
(RefSeq) neuroendocrine secretory protein 55
  KO
K04632  guanine nucleotide-binding protein G(s) subunit alpha
Organism
chx  Capra hircus (goat)
Pathway
chx01522  Endocrine resistance
chx04015  Rap1 signaling pathway
chx04020  Calcium signaling pathway
chx04024  cAMP signaling pathway
chx04072  Phospholipase D signaling pathway
chx04261  Adrenergic signaling in cardiomyocytes
chx04270  Vascular smooth muscle contraction
chx04540  Gap junction
chx04611  Platelet activation
chx04713  Circadian entrainment
chx04714  Thermogenesis
chx04724  Glutamatergic synapse
chx04726  Serotonergic synapse
chx04728  Dopaminergic synapse
chx04730  Long-term depression
chx04750  Inflammatory mediator regulation of TRP channels
chx04911  Insulin secretion
chx04912  GnRH signaling pathway
chx04913  Ovarian steroidogenesis
chx04915  Estrogen signaling pathway
chx04916  Melanogenesis
chx04918  Thyroid hormone synthesis
chx04921  Oxytocin signaling pathway
chx04922  Glucagon signaling pathway
chx04923  Regulation of lipolysis in adipocytes
chx04924  Renin secretion
chx04925  Aldosterone synthesis and secretion
chx04926  Relaxin signaling pathway
chx04927  Cortisol synthesis and secretion
chx04928  Parathyroid hormone synthesis, secretion and action
chx04934  Cushing syndrome
chx04935  Growth hormone synthesis, secretion and action
chx04961  Endocrine and other factor-regulated calcium reabsorption
chx04962  Vasopressin-regulated water reabsorption
chx04970  Salivary secretion
chx04971  Gastric acid secretion
chx04972  Pancreatic secretion
chx04976  Bile secretion
chx05012  Parkinson disease
chx05030  Cocaine addiction
chx05031  Amphetamine addiction
chx05032  Morphine addiction
chx05034  Alcoholism
chx05142  Chagas disease
chx05146  Amoebiasis
chx05163  Human cytomegalovirus infection
chx05165  Human papillomavirus infection
chx05200  Pathways in cancer
chx05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    108633189
   04020 Calcium signaling pathway
    108633189
   04072 Phospholipase D signaling pathway
    108633189
   04024 cAMP signaling pathway
    108633189
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    108633189
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    108633189
  09152 Endocrine system
   04911 Insulin secretion
    108633189
   04922 Glucagon signaling pathway
    108633189
   04923 Regulation of lipolysis in adipocytes
    108633189
   04912 GnRH signaling pathway
    108633189
   04913 Ovarian steroidogenesis
    108633189
   04915 Estrogen signaling pathway
    108633189
   04921 Oxytocin signaling pathway
    108633189
   04926 Relaxin signaling pathway
    108633189
   04935 Growth hormone synthesis, secretion and action
    108633189
   04918 Thyroid hormone synthesis
    108633189
   04928 Parathyroid hormone synthesis, secretion and action
    108633189
   04916 Melanogenesis
    108633189
   04924 Renin secretion
    108633189
   04925 Aldosterone synthesis and secretion
    108633189
   04927 Cortisol synthesis and secretion
    108633189
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    108633189
   04270 Vascular smooth muscle contraction
    108633189
  09154 Digestive system
   04970 Salivary secretion
    108633189
   04971 Gastric acid secretion
    108633189
   04972 Pancreatic secretion
    108633189
   04976 Bile secretion
    108633189
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    108633189
   04961 Endocrine and other factor-regulated calcium reabsorption
    108633189
  09156 Nervous system
   04724 Glutamatergic synapse
    108633189
   04728 Dopaminergic synapse
    108633189
   04726 Serotonergic synapse
    108633189
   04730 Long-term depression
    108633189
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    108633189
  09159 Environmental adaptation
   04713 Circadian entrainment
    108633189
   04714 Thermogenesis
    108633189
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108633189
  09164 Neurodegenerative disease
   05012 Parkinson disease
    108633189
  09165 Substance dependence
   05030 Cocaine addiction
    108633189
   05031 Amphetamine addiction
    108633189
   05032 Morphine addiction
    108633189
   05034 Alcoholism
    108633189
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    108633189
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    108633189
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    108633189
   05165 Human papillomavirus infection
    108633189
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    108633189
   05142 Chagas disease
    108633189
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    108633189
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:chx04147]
    108633189
   04031 GTP-binding proteins [BR:chx04031]
    108633189
Exosome [BR:chx04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   108633189
  Exosomal proteins of other body fluids (saliva and urine)
   108633189
  Exosomal proteins of colorectal cancer cells
   108633189
  Exosomal proteins of bladder cancer cells
   108633189
GTP-binding proteins [BR:chx04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 2 (Gs)
    108633189
SSDB
Motif
Pfam: NESP55
Other DBs
NCBI-GeneID: 108633189
NCBI-ProteinID: XP_013824182
UniProt: A0A452DQI6
LinkDB
Position
13
AA seq 241 aa
MDRRSRPQLGRRARHNYNDLCPPIGRRAATALLWLSCSIALLRALATSSTRAQQRAAAQR
RSFLNAHHRSAAQVFPEPPESDHEDTDLEPSLPECPEYQEEEFDYESETESESEIESETE
FETESDTAPTTEPETEPEDERGPVVPKRPTFHQSLTERLSALRLRSPDASPSRAPPSTQE
SESPRQREEPEDKDPRDPEESEEPKEEEKQQQRRCKPKKPTRRDPSPESPSKRGPIPIRR
H
NT seq 726 nt   +upstreamnt  +downstreamnt
atggatcgtagatcccgacctcaactagggcgccgagctcgccacaattacaacgatctg
tgcccacccataggccgccgggcagccacagcgctcctctggctctcctgctccatcgcg
ctcctccgcgcccttgccacctccagcacccgcgcccagcagcgcgcggctgcccagcgc
cggagcttcctgaacgcccaccaccgctctgcagcccaggtattccccgagccccctgaa
tctgaccacgaggacacagacctcgagccctcccttcccgagtgcccagagtaccaggaa
gaagagttcgactacgaatccgagaccgagtccgagtctgaaatcgagtccgagaccgaa
ttcgagaccgagtctgacaccgcccccaccactgagccggagaccgagcccgaggacgag
cggggccccgtggtgcccaagcgccccaccttccaccaatctctcaccgagcgtctcagc
gccctgaggctgcggagccccgacgcctccccgagtcgtgcgccgcccagtactcaggag
tctgagagccccagacaacgggaagagcccgaggacaaggatccgagggaccccgaagag
tctgaggagccaaaggaggaggagaagcagcagcagcgccgctgcaagccgaagaagccc
acccgccgcgacccatcccccgagtccccttccaaaagggggcccatccccatccggcgt
cactaa

DBGET integrated database retrieval system