KEGG   Capra hircus (goat): 102188970Help
Entry
102188970         CDS       T02910                                 

Gene name
GYS1
Definition
(RefSeq) glycogen synthase 1
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
chx  Capra hircus (goat)
Pathway
chx00500  Starch and sucrose metabolism
chx01100  Metabolic pathways
chx04151  PI3K-Akt signaling pathway
chx04152  AMPK signaling pathway
chx04910  Insulin signaling pathway
chx04922  Glucagon signaling pathway
chx04931  Insulin resistance
Module
chx_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:chx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    102188970 (GYS1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    102188970 (GYS1)
   04152 AMPK signaling pathway
    102188970 (GYS1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102188970 (GYS1)
   04922 Glucagon signaling pathway
    102188970 (GYS1)
 09160 Human Diseases
  09167 Endocrine and metabolic diseases
   04931 Insulin resistance
    102188970 (GYS1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:chx01003]
    102188970 (GYS1)
Enzymes [BR:chx01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     102188970 (GYS1)
Glycosyltransferases [BR:chx01003]
 Polysaccharide
  Storage polysaccharide
   102188970 (GYS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_4 Glyco_transf_5 Glycos_transf_1 Glyco_trans_4_4 Glyco_trans_1_4
Motif
Other DBs
NCBI-GeneID: 102188970
NCBI-ProteinID: XP_017918235
LinkDB All DBs
Position
18
AA seq 736 aa AA seqDB search
MPLNRTLSMSSLPGLEDWEDEFDLENTVLFEVAWEVANKVGGIYTVLQTKAKVTGDEWGD
NYYLVGPYTEQGVRTQVELLEPPTPALKRTLDSMNSKGCKVYFGRWLIEGGPLVVLLDVG
ASAWALERWKGELWDTCNIGVPWYDREANDAVLFGFLTTWFLGEFLAQSEEKPHVVAHFH
EWLAGVGLCLCRARRLPVATIFTTHATLLGRYLCAGAVDFYNNLENFNVDKEAGERQIYH
RYCMERAAAHCAHVFTTVSQITAIEAQHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQS
KARIQEFVRGHFYGHLDFNLDKTLYFFIAGRYEFSNKGADVFLEALARLNYLLRVNGSEQ
TVVAFFIMPARTNNFNVETLKGQAVRKQLWDTANTVKEKFGRKLYESLLVGSLPDMNKML
DKEDFTMMKRAIFATQRQSFPPVCTHNMLDDSSDPILTTIRRIGLFNSSADRVKVIFHPE
FLSSTSPLLPVDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVSTNLSGFGCFMEE
HIADPSAYGIYILDRRFRSLDDSCSQLTSFLYSFCQQSRRQRIIQRNRTERLSDLLDWKY
LGRYYMSARHMALAKAFPEYFTYEPHEADATQGYRYPRPASVPPSPSLSRHSSPHQSEDE
EEPRDLPPDEDGERYDEDEEAAKDRRNIRAPEWPRRASCTSSTGSKRGSVDTAPSSSVST
PSEPLSPASSLGEERN
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atgcctctaaaccgcactttgtccatgtcctccctgccaggactggaggactgggaggat
gaattcgacctggagaacacagtgctcttcgaggtggcctgggaggtggccaacaaggtg
ggcggcatctacacagtgctgcagacgaaggcaaaggtgacgggggatgagtggggcgac
aactactacctggtgggaccgtacacggagcagggcgtgaggacccaggtggagctgctg
gaacccccgacgccggccctgaagaggacgctggactccatgaacagcaagggctgcaag
gtgtacttcgggcgctggctgatcgaggggggccccctggtggtgctcctcgatgtgggg
gcctcagcctgggccctggagcgctggaagggggagctatgggacacatgcaacatcggg
gtgccctggtacgaccgggaggccaacgacgccgtccttttcggcttcctcaccacctgg
ttcctgggtgagttcctggcccagagtgaggagaaaccacatgtggttgcacacttccac
gagtggctagcaggcgtcgggctctgcctgtgccgcgcccggcggctgcccgtggctacc
atcttcaccacccacgccacgctgctggggcgatacctgtgtgccggggccgtggacttc
tacaacaacctggagaatttcaacgtggacaaagaagcaggtgagaggcaaatctatcac
cgctactgcatggagcgggccgcagcccactgtgctcacgtcttcactactgtgtcccag
attaccgccatcgaggctcagcacctactcaaaaggaaaccagatatcgtgacccccaat
ggactgaatgtgaagaaattctctgccatgcatgagttccagaacctccatgctcagagc
aaggctcgaatccaggagtttgtgcggggccatttttatgggcacctagacttcaacttg
gacaagaccttgtacttctttattgccggccgctatgagttctccaacaagggggccgac
gtcttcctggaggccttggcccggctcaactatctgctcagagtgaatggcagcgagcag
acggtggttgccttcttcatcatgccggctcggaccaacaatttcaacgtggaaaccctt
aagggccaggccgtgcgcaagcagctttgggatacagccaacacagtgaaggaaaagttt
gggaggaagctttacgaatccttgctggtgggaagcctcccagacatgaacaagatgctg
gacaaggaggacttcactatgatgaagagagccatctttgccacgcagcggcaatctttc
cctcctgtgtgcacccacaatatgctggatgactcctcagaccccatcttgacaaccatc
cgccgaatcggcctcttcaatagtagtgctgacagagtcaaggtgattttccacccggag
ttcctgtcctctacgagccctctgctccctgtggactatgaggaatttgtccgtggctgc
caccttggggtcttcccctcctactatgagccttggggctacacaccagctgagtgcacg
gtaatgggtatccccagtgtctccaccaacctctccggattcggctgcttcatggaggaa
cacatcgcagacccctcagcttacggtatctacattctggaccggcgattccgcagcttg
gatgattcctgctcgcagctcacctccttcctctacagtttctgccagcagagccgaagg
cagcgcattatccagcggaaccgaacggagcgcctctctgatcttctggactggaaatac
ctaggccggtactacatgtcagcgcgccacatggcgctggccaaggcctttccagaatac
ttcacctacgagcctcacgaggctgacgcgacccagggctaccgctacccacggccagcc
tcagtgccaccatcaccctcgctgtcgcgacactccagcccgcaccagagcgaggatgag
gaggaaccccgggacttaccaccggatgaagatggcgaacgctacgacgaggacgaggag
gccgccaaggaccggcgcaatatccgcgcgcccgagtggccgcgccgcgcctcctgcacc
tcttccaccgggagcaagcgcgggtcggtggacacggcgccctccagctcagtcagcacc
cccagcgaaccccttagccccgccagctccctgggcgaggaacgcaactaa

DBGET integrated database retrieval system