KEGG   Capra hircus (goat): 102189015Help
Entry
102189015         CDS       T02910                                 

Gene name
GYS2
Definition
(RefSeq) glycogen synthase 2
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
chx  Capra hircus (goat)
Pathway
chx00500  Starch and sucrose metabolism
chx01100  Metabolic pathways
chx04151  PI3K-Akt signaling pathway
chx04152  AMPK signaling pathway
chx04910  Insulin signaling pathway
chx04922  Glucagon signaling pathway
chx04931  Insulin resistance
Module
chx_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:chx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    102189015 (GYS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    102189015 (GYS2)
   04152 AMPK signaling pathway
    102189015 (GYS2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102189015 (GYS2)
   04922 Glucagon signaling pathway
    102189015 (GYS2)
 09160 Human Diseases
  09167 Endocrine and metabolic diseases
   04931 Insulin resistance
    102189015 (GYS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:chx01003]
    102189015 (GYS2)
Enzymes [BR:chx01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     102189015 (GYS2)
Glycosyltransferases [BR:chx01003]
 Polysaccharide
  Storage polysaccharide
   102189015 (GYS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glycos_transf_1 Glyco_trans_4_4 Glyco_transf_4 Glyco_trans_1_4
Motif
Other DBs
NCBI-GeneID: 102189015
NCBI-ProteinID: XP_005680843
LinkDB All DBs
Position
5
AA seq 702 aa AA seqDB search
MLRGRSLSVTSLGGLPRWEAGLPVENLLLFEVSWEVTNKVGGIYTVIQTKAKTTADEWGD
NYFLIGPYFEHNMKTQVEQCEPVNDAVRRAMDAMNKHGCQVRFGRWLIEGSPYVVLFDIG
YSAWNLDKWKGDLWEACNIGIPYHDQEANDMLIFGSLTAWFLKEVTDHADGRHVIVQFHE
WQAGIGLILSRARKLPIATVFTTHATLLGRYLCAANIDFYNHLDKFNIDKEAGERQIYHR
YCMERASVHCAHVFTTVSEITAIEAEHMLKRKPDVVTPNGLNVKKFSAVHEFQNLHAMYK
ARIQEFVRGHFYGHLDFDLEKTLFLFIAGRYEFSNKGADIFLESLSRLNFLLRMHKSDVT
VVVFFIMPAKTNNFNVETLKGQAVRKQLWDTAHSVKEKFGKKLYDALLRGEIPDMNNILD
RDDQTIMKRAIFSTQRQSLPPVTTHNMIDDSTDPILSTIRRIGLFNSRTDRVKLILHPEF
LSSTSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMQEH
VADPTAYGIYIVDRRFRSPDDSCNQLTQFLYGFCKQSRRQRIIQRNRTERLSDLLDWRYL
GRYYQHARLLTLSRAFPEKFHMEPTSPPTTEGFKYPRPPSVPPSPSGSQASSPQSSDAED
DDEDERYDEEEEAERDRLNIKSPFSLSHVPRGKKKQHGEYKN
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgaggtcggtcgctatctgtgacatccctaggtgggctgcctcggtgggaagcc
ggacttcctgtggagaatttactgctctttgaagtctcttgggaagtgaccaataaagtc
ggtggcatctataccgtgattcagacaaaggccaaaacaacagcagatgaatggggagac
aactattttctgattggtccatattttgagcataatatgaagactcaggtggaacagtgt
gaacctgtgaatgatgctgttagaagagccatggatgcgatgaacaaacacggctgccag
gtgcgctttggaagatggctaatagaagggagtccttacgtggttctctttgacattggc
tattcggcttggaacctggacaagtggaaaggagacctctgggaagcatgcaacattggc
attccttatcacgaccaggaagccaatgatatgctgatctttgggtcattaactgcctgg
ttcttgaaagaggtgacggaccatgctgatgggagacacgtcattgtccagttccatgaa
tggcaagctgggattggactgatcctttctcgagctcggaaactgcccattgctacagtc
tttaccacccacgccaccctgcttgggcggtatctctgtgcagctaacatcgatttctac
aaccaccttgataagtttaacatagacaaagaggctggggaaaggcagatttatcaccgg
tattgcatggagcgcgcttccgtccattgtgctcatgttttcaccacagtttctgaaatt
acagcaatcgaggcagaacacatgctgaagagaaaacctgatgtagttactccaaatggc
ttgaacgttaagaaattttcagctgtacatgagtttcaaaatctccatgctatgtacaag
gccaggatccaagagtttgttcgaggtcatttctatggtcatctggactttgatcttgaa
aaaacgttgttcctcttcattgctgggaggtatgagttttcaaacaaaggagctgacatc
ttcttagaatccttatccaggttaaacttcctgctgaggatgcataaaagtgacgtcacc
gtggtggtgtttttcattatgcctgccaagacaaataatttcaatgtggaaaccctgaaa
ggccaggcagtgcgcaaacagctatgggacactgcacattctgtgaaggaaaagtttgga
aagaaactgtatgatgcattattaagaggagaaattcctgacatgaacaatattttggat
cgagatgatcagacaattatgaaaagagctatcttttcaactcagcggcagtctttgccc
ccagtgaccactcacaacatgatcgatgattccaccgatcccatcctcagcaccattaga
cgcattgggctcttcaatagccgcacagacagagtcaagttgattttgcacccagagttc
ctgtcctccaccagccccttgctacccatggattatgaagagtttgtccgaggttgtcat
cttggagtatttccatcatactatgaaccctggggttatactccagctgaatgcactgtg
atgggcatccccagtgtgaccaccaatctctctggctttggctgtttcatgcaggagcat
gtggctgaccccaccgcatacggaatttacatcgttgacaggcggttccgctcacctgat
gattcttgcaatcaactgactcagtttctctacggattttgcaaacagtcacgccgccag
aggattattcaaaggaatcgaaccgagaggctctcagatcttctggactggagatactta
ggcagatattaccagcatgccaggctcctgacattaagtagagcctttccagagaaattc
cacatggaacccacatcaccaccaacgacagaagggtttaagtatcccaggccgccctcg
gtaccaccttctccgtcgggatctcaggcctccagtcctcagagcagtgatgcggaggat
gacgatgaggatgagagatacgacgaggaggaagaggcggaaagggatcggttaaatatc
aagtcgcccttttctctgagtcacgttcctcgcggaaagaagaagcagcacggagaatac
aagaactga

DBGET integrated database retrieval system