KEGG   Capra hircus (goat): 102189170
Entry
102189170         CDS       T02910                                 

Gene name
STAT1
Definition
(RefSeq) signal transducer and activator of transcription 1
  KO
K11220  signal transducer and activator of transcription 1
Organism
chx  Capra hircus (goat)
Pathway
chx04062  Chemokine signaling pathway
chx04217  Necroptosis
chx04380  Osteoclast differentiation
chx04620  Toll-like receptor signaling pathway
chx04621  NOD-like receptor signaling pathway
chx04625  C-type lectin receptor signaling pathway
chx04630  JAK-STAT signaling pathway
chx04658  Th1 and Th2 cell differentiation
chx04659  Th17 cell differentiation
chx04917  Prolactin signaling pathway
chx04919  Thyroid hormone signaling pathway
chx04933  AGE-RAGE signaling pathway in diabetic complications
chx04935  Growth hormone synthesis, secretion and action
chx05140  Leishmaniasis
chx05145  Toxoplasmosis
chx05152  Tuberculosis
chx05160  Hepatitis C
chx05161  Hepatitis B
chx05162  Measles
chx05164  Influenza A
chx05165  Human papillomavirus infection
chx05167  Kaposi sarcoma-associated herpesvirus infection
chx05168  Herpes simplex virus 1 infection
chx05169  Epstein-Barr virus infection
chx05171  Coronavirus disease - COVID-19
chx05200  Pathways in cancer
chx05212  Pancreatic cancer
chx05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
chx05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102189170 (STAT1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102189170 (STAT1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102189170 (STAT1)
   04621 NOD-like receptor signaling pathway
    102189170 (STAT1)
   04625 C-type lectin receptor signaling pathway
    102189170 (STAT1)
   04658 Th1 and Th2 cell differentiation
    102189170 (STAT1)
   04659 Th17 cell differentiation
    102189170 (STAT1)
   04062 Chemokine signaling pathway
    102189170 (STAT1)
  09152 Endocrine system
   04917 Prolactin signaling pathway
    102189170 (STAT1)
   04935 Growth hormone synthesis, secretion and action
    102189170 (STAT1)
   04919 Thyroid hormone signaling pathway
    102189170 (STAT1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102189170 (STAT1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102189170 (STAT1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102189170 (STAT1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102189170 (STAT1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    102189170 (STAT1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102189170 (STAT1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102189170 (STAT1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    102189170 (STAT1)
   05160 Hepatitis C
    102189170 (STAT1)
   05171 Coronavirus disease - COVID-19
    102189170 (STAT1)
   05164 Influenza A
    102189170 (STAT1)
   05162 Measles
    102189170 (STAT1)
   05168 Herpes simplex virus 1 infection
    102189170 (STAT1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102189170 (STAT1)
   05169 Epstein-Barr virus infection
    102189170 (STAT1)
   05165 Human papillomavirus infection
    102189170 (STAT1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102189170 (STAT1)
   05140 Leishmaniasis
    102189170 (STAT1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:chx03000]
    102189170 (STAT1)
Transcription factors [BR:chx03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    102189170 (STAT1)
SSDB
Motif
Pfam: STAT_alpha STAT_bind STAT_int STAT1_TAZ2bind SH2 TRPM_tetra NPV_P10
Other DBs
NCBI-GeneID: 102189170
NCBI-ProteinID: XP_017917036
UniProt: A0A452E166
LinkDB
Position
2
AA seq 749 aa
MSQWYELQQLESKYLEQVHQLYDDSFPMEIRQYLAQWLEKQDWEHAANDVSFATIRFHDL
LSQLDDQYSRFSLENNFLLQHNIRKSKRNLQDNFQEDPILMSMIICNCLKEERKILDHAQ
RISQAQSGNIQSTVMLDKQKELDSKVRNVKDKVMSIEHEIKTLEDLQDEYDFKCKTLQNR
EHETNGVAKNDQKQEQLLLQKMYLMLDNKRKEVVLKIIELLNATELTQKALINDELVEWK
RRQQSACIGGPPNACLDQLQNWFTIVAESLQQVRQQLKKLEELEQKYTYEHDPITKNKQA
LWDRTFNLFQQLIQSSFVVERQPCMPTHPQRPLVLKTGVQFTVKLRLLVKLQELNYNLKV
KVLFDKDVNERNTVKGFRKFNILGTHTKVMNMEESTNGSLAAEFRHLQLKEQKNAGARTN
EGPLIVTEELHSLSFETQLCQPGLVIDLETTSLPVVVISNVSQLPSGWASILWYNMLVAE
PRNLSFFLNPPCARWSQLSEVLSWQFSSVTKRGLNVDQLNMLGEKLLGPNAGPDGLIPWT
RFCKENINDKNFPFWLWIESILELIKKHLLALWNDGCIVGFISKERERALLKDQQPGTFL
LRFSESCREGAITFTWVERSQNGGEPYFHAVEPYTKKELSAVTFPDIIRNYKVMAAENIP
ENPLKFLYPNIDKDHAFGKYYSRPKEAPEPMELDGPKGTGYIKTELISVSEVHPSRLQTT
DNLLPMSPEEFDEVSRMVGSVEFDMMNAV
NT seq 2250 nt   +upstreamnt  +downstreamnt
atgtcccagtggtatgagcttcagcagcttgagtccaaatacctggagcaggttcaccag
ctctatgatgacagttttcccatggaaatcagacaatatctggcacagtggctagaaaag
caagactgggagcatgctgccaacgatgtttcatttgccaccatccgttttcatgaccta
ctatcgcagctggatgatcaatacagtcgcttttctttggagaataactttttattgcaa
cataacataaggaaaagcaagcgtaaccttcaggataattttcaggaagacccaatactg
atgtctatgatcatctgtaactgtctgaaggaggaaagaaagatcttggatcatgcccag
agaatcagccaggcgcagtccgggaatattcagagcactgtaatgttagacaaacagaag
gagcttgacagcaaagtcagaaatgtgaaagacaaagttatgagtattgaacatgaaatc
aagaccctagaagatttgcaagatgaatatgactttaaatgtaaaaccttgcaaaacaga
gaacatgaaaccaatggcgtggcaaagaatgatcagaaacaagaacaattgttactccag
aagatgtacttaatgctggacaataagagaaaggaagtcgttcttaaaataatagagttg
ttgaatgccaccgaacttacccagaaagccctgattaatgatgaactggtggagtggaag
cggagacagcagagtgcctgtattggggggccccccaatgcttgcctggatcagctgcaa
aattggttcactatagtggcggagagtctgcagcaggttcgtcagcagcttaaaaagctt
gaagagttggaacagaaatacacctatgaacatgaccccatcaccaaaaacaagcaagcc
ttatgggaccgcaccttcaacctcttccagcagctcattcagagctcatttgtggtggaa
agacagccctgcatgccaactcaccctcagaggccattggtcttgaagactggagtccaa
ttcactgtgaaactgaggctgctggtgaagttgcaagagctgaattataacttgaaagtc
aaagtcttgtttgacaaagatgtgaatgagagaaacacagtaaaagggtttaggaagttc
aacattctgggcactcacacgaaggtgatgaacatggaagagtccaccaacgggagtctg
gcggcagaattccgacacctgcaactgaaagaacaaaaaaatgccggtgccagaactaat
gagggtcctctcatcgtcactgaagagcttcactctcttagttttgaaacccagttgtgc
cagcctggtttggtcattgacctggagacgacctctctacccgtcgtggtgatctccaat
gtcagccagctcccaagtggctgggcctctatcctgtggtacaacatgctggtggcagaa
ccccggaatctgtccttcttcctgaacccaccatgtgcacgatggtctcagctttcagag
gtgctgagctggcagttttcttctgtcaccaaaagaggtctcaatgtggaccagctgaac
atgctgggggagaaacttcttggccccaacgccggccccgatggtctgattccatggaca
aggttctgtaaggaaaacataaatgataaaaattttccattctggctttggatcgaaagc
atccttgaactcattaaaaaacacctacttgctctctggaatgacgggtgtatcgtgggc
tttattagcaaggagcgagagcgagccctgctgaaggaccagcagcccgggacgttcctg
ctgcgcttcagcgagagctgccgggaaggggcgatcacgttcacgtgggtggaacggtcc
cagaatggaggcgaaccttacttccatgcggttgaaccctacacaaagaaagaactttct
gcggttacttttcctgacattattcgcaattataaagtcatggctgctgaaaatattcca
gagaatcccctgaagtttctgtatccaaatattgataaagaccatgcctttggaaaatac
tactccaggccaaaggaagccccagagcctatggaacttgatggccctaaaggaacagga
tacatcaagactgaattgatttctgtgtctgaagttcacccttctcgacttcagaccaca
gacaaccttcttcccatgtctcctgaggagtttgacgaggtgtctcggatggtgggctct
gtagaattcgatatgatgaatgcggtctag

DBGET integrated database retrieval system