KEGG   Capra hircus (goat): 102189201Help
Entry
102189201         CDS       T02910                                 

Definition
(RefSeq) allergen Bos d 2
Organism
chx  Capra hircus (goat)
SSDB OrthologParalogGFIT
Motif
Pfam: Lipocalin DUF5093 GH43_C
Motif
Other DBs
NCBI-GeneID: 102189201
NCBI-ProteinID: XP_005701296
UniProt: A0A452FM46
LinkDB All DBs
Position
X
AA seq 172 aa AA seqDB search
MKVVFLTLLCGLVGAAQETPAEIDPSKIPGEWRTIYAAADNKDKIVEGGPLRNYYRRVEC
INDCESLSITFYLKDDGTCLLLTEVAKRKEGYVYVIQFDGTNTLEVIHVSENMLVTYVEN
YDGERITKMTEGLAKGTSFTQEELQKYQQLNSERGVPNENIENVIETDNCPP
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtcgtgttcctgactctcctctgtggtctggttggtgctgcccaggaaactcca
gctgagatagacccctcaaagattccaggagagtggcgtaccatttacgcagctgcagat
aacaaggacaagattgtggaagggggcccgctgaggaattactatcgtcgggttgaatgc
atcaatgactgtgaatctctctccattacattttatctcaaggacgatggcacatgtctg
ttgctcacagaagtggcaaagagaaaagaaggatatgtgtacgtcatacaattcgacggt
accaatactttggaagtgattcatgtgtcagaaaacatgctggtaacttatgttgaaaat
tatgatggggagaggatcacaaaaatgactgaaggtcttgccaaaggaaccagtttcact
caagaagaacttcagaagtatcagcagctgaacagtgaaaggggggttccaaatgaaaat
atagaaaatgtcatcgaaacagacaattgtcctccataa

DBGET integrated database retrieval system