KEGG   Capra hircus (goat): 102189617Help
Entry
102189617         CDS       T02910                                 

Gene name
MAP3K14
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 14
  KO
K04466  mitogen-activated protein kinase kinase kinase 14 [EC:2.7.11.25]
Organism
chx  Capra hircus (goat)
Pathway
chx04010  MAPK signaling pathway
chx04064  NF-kappa B signaling pathway
chx04210  Apoptosis
chx04380  Osteoclast differentiation
chx04625  C-type lectin receptor signaling pathway
chx04660  T cell receptor signaling pathway
chx04668  TNF signaling pathway
chx04672  Intestinal immune network for IgA production
chx05166  Human T-cell leukemia virus 1 infection
chx05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102189617 (MAP3K14)
   04064 NF-kappa B signaling pathway
    102189617 (MAP3K14)
   04668 TNF signaling pathway
    102189617 (MAP3K14)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102189617 (MAP3K14)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102189617 (MAP3K14)
   04660 T cell receptor signaling pathway
    102189617 (MAP3K14)
   04672 Intestinal immune network for IgA production
    102189617 (MAP3K14)
  09158 Development
   04380 Osteoclast differentiation
    102189617 (MAP3K14)
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05166 Human T-cell leukemia virus 1 infection
    102189617 (MAP3K14)
   05169 Epstein-Barr virus infection
    102189617 (MAP3K14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:chx01001]
    102189617 (MAP3K14)
Enzymes [BR:chx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     102189617 (MAP3K14)
Protein kinases [BR:chx01001]
 Serine/threonine kinases: STE group
  Other
   102189617 (MAP3K14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH
Motif
Other DBs
NCBI-GeneID: 102189617
NCBI-ProteinID: XP_017920755
LinkDB All DBs
Position
19
AA seq 953 aa AA seqDB search
MAVMEMACPGAPGSTVGQQKEFAKAKEKTQVMGKKQSSVHKLEAVEKSPVFCGKWEILND
VITKGTAKDGSEAGPAAISIIAQAECENSQEFSPTFSERIFIAGSKQYSQSESLDQIPNN
VAHSTEGKMARVCWKGKRRSKARKKRKKKSSKSPAQAGVALAKPLPRTPEQESCTVPVQE
DESPLGPPYVRNVPQFTKPLKEPDLGQLWFKKLGEGLRPALPRPELHKLISPLQCLNHVW
KVHHPQDAGPLPQPFPYSRLPHPFPFHPLQPWKPHPLESFFLGKLANCVDDQQPLPGPHL
GRLACVDSQQPLPRPHLQPSCPSRGSRDKLSVEEYLVHALQGSVSSGQPHSLASLAKTWS
VGGSRPQAPSPETEDSEGVLLIEKLKPVDYEYREEVHWATRQPCLGRGSFGEVHRMEDKQ
TGFQCAVKKVRVEVFRAEELMACAGLTSPRIVPLYGAVKEGPWVNIFMELLEGGSLGQLI
KQKGCLPEDRALYYLGQALEGLEYLHTRRILHGDVKADNVLLSSDGSRAALCDFGHAVCL
QPDGLGKSLLTGDYIPGTETHMAPEVVMGKPCDAKVDVWSSCCMMLHMLNGCHPWTQYFR
GPLCLKIASEPPPVREIPASCAPLTAQAIQEGLRKEPVHRASAVELGGKVSLALQHVGGL
RSPWRGEYKEPRHPLPLQAHPPPSQGHPHQTLHAPPGELSPGAPGLQPAKDAAGGAPKLQ
PPPPPDPPEQSKSPSLHWGKEESGTWDPLPLSSLDPAPARNPSSPERKATFPEQELQQLE
IELFLNSLSQPFSLEEQEQILSCLSVDSLSLSDDSEKNPSKASQSSRDTLSSGVHSWSSQ
AEARSSSWNMVLARGRPTDTPSYFNGVKVQIQSLNGEHLHIREFHRAKVGDIATGISSQI
PAAAFSLVTKDGQPVRYDMEVPDSGIDLQCTLAPDGSFAWSWRVKHGQLENRP
NT seq 2862 nt NT seq  +upstreamnt  +downstreamnt
atggcagtgatggaaatggcctgcccaggcgcccccggctccacggtcgggcagcagaag
gagttcgccaaagccaaggagaagacacaggtgatggggaagaaacagagctccgtccac
aagctggaggccgtggagaagagccccgtgttctgcgggaagtgggagatcctgaacgac
gtgatcaccaaaggcacagccaaggacggctccgaggctgggccagctgccatctccatc
atcgcccaggctgagtgtgagaacagccaagagttcagccccaccttttcagaacggatc
ttcatcgctggctcgaaacagtacagccagtccgagagtcttgatcagatccccaacaat
gtggcccactcgactgagggcaaaatggcccgtgtgtgctggaaggggaagcgccgcagc
aaagcccggaagaaacgcaagaagaagagctccaagtcccctgctcaggcgggggtagcc
ttggccaaacccctccccaggacccccgagcaggagagctgcacagtcccggtgcaggag
gatgagtctccactgggtcctccgtatgttagaaatgtgccgcagttcaccaagcctctg
aaggagccagaccttggtcagctctggtttaagaagctcggggagggcctgcggccagcg
ctgcctcgaccagaactccacaaactgatcagccccctgcagtgtctgaaccacgtgtgg
aaggtccaccacccacaggacgccggccccctgccccagcctttcccctacagcaggctg
cctcaccccttcccattccacccactccagccctggaagcctcacccgctcgagtccttc
ttccttggcaaactggcaaactgtgtagacgaccagcagcccctgcccggccctcacctg
ggcagactggcctgtgtagacagccagcagcccctgccccgccctcacctgcagcccagc
tgcccgtctcgtggctcaagggacaagctgtccgtggaggagtacctggtacatgccctg
caaggcagcgtgagctccggccagccccacagcctggccagcctggccaagacctggtca
gtggggggctccaggccccaggcgcccagccccgaaactgaggacagcgagggggtccta
ctcattgagaaactcaagccggtggattatgagtaccgagaggaggtccactgggccacg
cgccagccctgcctgggcagaggctcctttggagaggtccacaggatggaggacaagcag
accggcttccagtgtgccgtcaaaaaggtgcgagtcgaagtatttcgggccgaggagttg
atggcatgtgcaggattgacctcccccagaatcgtccctttgtatggagctgtgaaggaa
gggccttgggtcaacatcttcatggaactgctggaaggtggttcgctaggccagcttata
aaacagaaaggctgtctgccagaggaccgggccctttactacctgggccaggcgctggaa
gggctggaatacctccatacccgcaggattctacacggagatgtgaaagccgacaacgtg
ctcctgtccagtgatgggagccgcgcagccctctgcgactttggccacgctgtgtgcctt
caacccgatggcctggggaagtctttgctcacaggggactacatccccggtacagagacc
cacatggcgccagaggtggtgatgggcaagccctgcgacgccaaggtggacgtctggagc
agctgctgtatgatgctgcacatgctcaacggctgccacccctggacccaatacttccga
ggaccgctctgcctcaagattgccagtgagcctccacctgtgagggagatcccggcctcc
tgtgccccgctcacggcccaggccatccaggaggggctcaggaaagagccggtccaccga
gcatctgcagtggagctgggggggaaggtcagcctggcgctgcagcacgtgggaggtctg
aggagtccctggagaggagagtacaaagaaccaagacatccactgccactccaagcccac
ccaccgccaagccaaggccaccctcaccagaccctgcatgccccgccaggggagctctca
ccaggggccccggggctgcagccggctaaggacgcagcaggcggggcccctaagctccag
cctcctccacctccagaccccccagagcagagcaagtcgcccagcctgcactggggcaag
gaggagtctgggacatgggatccattgcccctgtcctccctggatccggcccccgccagg
aaccccagctcacctgagcgaaaggcaacctttcctgagcaggagctacagcagctggag
atagagttatttctgaacagcctgtcccagccattctccctggaggagcaggagcagatc
ctctcgtgcctcagcgtcgacagcctctccctgtcagacgacagtgagaagaacccgtcc
aaggcttctcagagctcacgggacacactgagttccggcgtgcactcgtggagcagccag
gcggaggcccgcagctccagctggaacatggtgctggcccgggggcggcccactgacaca
ccaagctatttcaacggtgtgaaagtccaaatacagtctctcaatggcgaacacctgcac
atccgggaattccaccgggccaaggtgggagacatcgcaacgggcatcagcagccagatc
ccagctgcagccttcagcttggtgaccaaggacgggcagcccgtgcgctacgacatggag
gtgccggactcaggcatcgacttgcagtgcaccctggccccagacggcagcttcgcctgg
agctggagggtcaagcacggccagctggagaacaggccctaa

DBGET integrated database retrieval system