KEGG   Capra hircus (goat): 102189859
Entry
102189859         CDS       T02910                                 

Gene name
NR3C1
Definition
(RefSeq) nuclear receptor subfamily 3 group C member 1
  KO
K05771  glucocorticoid receptor
Organism
chx  Capra hircus (goat)
Pathway
chx04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102189859 (NR3C1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:chx03000]
    102189859 (NR3C1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:chx03310]
    102189859 (NR3C1)
Transcription factors [BR:chx03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    102189859 (NR3C1)
Nuclear receptors [BR:chx03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   102189859 (NR3C1)
SSDB
Motif
Pfam: GCR Hormone_recep zf-C4 SCA7
Other DBs
NCBI-GeneID: 102189859
NCBI-ProteinID: XP_005683143
LinkDB
Position
7
AA seq 782 aa
MDPKESLSTPSREEIPSSVLGRERGNVMDFYKTLRGGATVKVSASSPSLAAASHSDSKQQ
RLLVDFPKGSGSNAQQPDLSKAVSLSMGLYMGETETKVMGNDLGFPQQGQISLSSGETDF
RLLEESIANLSRSTSVPEKPKNSASAAVSAAPTEKEFPKTHSDVSSEQQNLKGQKGSNGG
SMKLHTTDQSTFDIWRKKLQDLEFSSESPSKETSESHWRSELLIDENCFLSPLAGEDDSF
LLEGSSNEDCKPLLLPDAKPKIKDNGDLILPSPNSVPLPQVKTEKEDFIELCTPGVIKQE
KLGPVYCQASFSGANIIGNKMSAISVHGVSTSGGQMYHYDMNTASLSQQQDQKPIFNVIP
PIPVGSENWNRCQGSGDDSLTSLGTLNFSGRSVFSNGYSSPGMRPDVSSPPSSSSAATGP
PPKLCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGRQHNYLCAGRNDCIIDKIRRKNCPA
CRYRKCLQAGMNLEARKTKKKIKGIQQATTGVSQETSENPANKTIVPATLPQLTPTLVSL
LEVIEPEVLYAGYDSSVPDSTWRIMTALNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTL
LQYSWMFLMAFALGWRSYRQSSANMLCFAPDLVINEQRMALPCMYDQCKHMLYVSSELSR
LQVSYEEYLCMKTLLLLSSVPKEGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRF
YQLTKLLDSMHDVVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSSGNIKKLLFH
QK
NT seq 2349 nt   +upstreamnt  +downstreamnt
atggaccccaaggagtcattaagcacccccagtagagaagaaatccccagcagtgtgctt
ggtcgagagaggggaaatgtgatggacttctataaaaccctaaggggaggagctactgtg
aaggtttctgcatcttccccctcactggctgctgcttctcactcagactccaagcagcaa
agacttctggttgattttccaaaaggctcaggaagcaatgcgcagcagccagatctgtcc
aaggcagtttcactgtcaatgggactgtacatgggagagacagagacaaaagtgatggga
aatgacctgggattcccacagcagggccaaatcagcctttcctctggggaaacagacttt
cggcttctggaagaaagcatcgcaaacctcagtaggtcaaccagtgttccagaaaagccc
aagaattctgcatccgctgctgtctctgctgcccccacagagaaggagtttccaaaaact
cactctgatgtgtcttcagaacagcagaatttgaaaggccagaagggcagtaacgggggt
agtatgaagttgcataccacagaccaaagcacctttgacatttggaggaaaaagctccag
gatttggagttttcttctgagtccccaagtaaagagacaagtgagagtcattggagatca
gaactcttgatagatgaaaactgtttcctttctcctttggcaggagaggatgattcattc
cttctggaaggaagctcgaatgaggactgtaagcctcttcttttaccggacgctaagcct
aaaattaaagataatggagatttgatcttaccaagtcctaacagtgtgccactgccccaa
gtgaaaacagaaaaagaagattttatcgaactctgcacccctggggtaattaagcaggag
aaactgggcccagtttattgtcaggccagcttttctggggccaacataattggcaataaa
atgtctgccatttctgttcatggtgtgagtacctctgggggacagatgtaccactacgac
atgaacacagcatccctttctcaacagcaggatcagaaacctatttttaatgtcattcca
ccaattcctgttggttcagaaaattggaatagatgccaggggtctggagatgacagcttg
acttccttggggactttgaacttctctggtcgatctgttttttctaacggctattcaagc
cctggaatgagaccagacgtaagctctcctccatccagttcctcagcagctacgggacca
cctcccaaactctgcctagtctgctctgatgaagcttcgggatgtcattatggggtcttg
acttgtggaagctgtaaagtattcttcaaaagagcagtggaaggtagacagcacaattat
ctttgtgctggaagaaatgattgtatcattgataaaattcgaagaaaaaactgcccagca
tgccgctatagaaaatgtcttcaagctggaatgaacctggaagctcgaaaaacaaagaaa
aagataaaaggaattcagcaggccactacaggagtctcgcaagaaacttctgaaaatcct
gctaacaaaacaatagttcctgcaacattaccacaactcacgcccacactggtgtcactg
ctggaagtcattgaacccgaggtgttatatgcaggatatgacagctctgttccagattca
acttggcggatcatgaccgcactcaacatgttaggtgggcggcaggtgattgcagcagtg
aaatgggcaaaggcaataccaggattcaggaacttacatctggatgaccaaatgactctg
ctgcagtattcatggatgttcctcatggcattcgccctggggtggagatcatacagacag
tcaagcgcaaatatgctgtgttttgctcctgatctggttattaatgagcagagaatggct
ttaccctgcatgtatgaccaatgtaaacatatgctatatgtttcctctgagttaagcagg
cttcaggtatcttacgaagagtatctctgtatgaaaaccttactgctcctctcttcagtt
cctaaggaaggcttgaagagtcaagaactatttgatgaaattagaatgacctacatcaaa
gagctaggaaaagccattgtcaagagggaaggaaactccagtcagaactggcagcggttt
tatcaactgacaaaactcttggactccatgcatgatgtggttgaaaatcttcttaactat
tgcttccaaacatttttggataagactatgagtattgaattcccagagatgttagctgaa
atcatcaccaatcagataccaaaatattcaagtggaaatatcaaaaaacttctgtttcat
caaaagtga

DBGET integrated database retrieval system