KEGG   Capra hircus (goat): 102189930
Entry
102189930         CDS       T02910                                 

Gene name
BAD
Definition
(RefSeq) BCL2 associated agonist of cell death
  KO
K02158  Bcl-2-antagonist of cell death
Organism
chx  Capra hircus (goat)
Pathway
chx01521  EGFR tyrosine kinase inhibitor resistance
chx01522  Endocrine resistance
chx01524  Platinum drug resistance
chx04012  ErbB signaling pathway
chx04014  Ras signaling pathway
chx04022  cGMP-PKG signaling pathway
chx04024  cAMP signaling pathway
chx04062  Chemokine signaling pathway
chx04140  Autophagy - animal
chx04151  PI3K-Akt signaling pathway
chx04210  Apoptosis
chx04370  VEGF signaling pathway
chx04510  Focal adhesion
chx04722  Neurotrophin signaling pathway
chx04910  Insulin signaling pathway
chx04919  Thyroid hormone signaling pathway
chx05010  Alzheimer disease
chx05014  Amyotrophic lateral sclerosis
chx05020  Prion disease
chx05022  Pathways of neurodegeneration - multiple diseases
chx05145  Toxoplasmosis
chx05152  Tuberculosis
chx05160  Hepatitis C
chx05161  Hepatitis B
chx05162  Measles
chx05165  Human papillomavirus infection
chx05168  Herpes simplex virus 1 infection
chx05170  Human immunodeficiency virus 1 infection
chx05200  Pathways in cancer
chx05203  Viral carcinogenesis
chx05210  Colorectal cancer
chx05211  Renal cell carcinoma
chx05212  Pancreatic cancer
chx05213  Endometrial cancer
chx05215  Prostate cancer
chx05218  Melanoma
chx05220  Chronic myeloid leukemia
chx05221  Acute myeloid leukemia
chx05223  Non-small cell lung cancer
chx05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102189930 (BAD)
   04014 Ras signaling pathway
    102189930 (BAD)
   04370 VEGF signaling pathway
    102189930 (BAD)
   04024 cAMP signaling pathway
    102189930 (BAD)
   04022 cGMP-PKG signaling pathway
    102189930 (BAD)
   04151 PI3K-Akt signaling pathway
    102189930 (BAD)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102189930 (BAD)
  09143 Cell growth and death
   04210 Apoptosis
    102189930 (BAD)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102189930 (BAD)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    102189930 (BAD)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102189930 (BAD)
   04919 Thyroid hormone signaling pathway
    102189930 (BAD)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102189930 (BAD)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102189930 (BAD)
   05203 Viral carcinogenesis
    102189930 (BAD)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102189930 (BAD)
   05212 Pancreatic cancer
    102189930 (BAD)
   05225 Hepatocellular carcinoma
    102189930 (BAD)
   05221 Acute myeloid leukemia
    102189930 (BAD)
   05220 Chronic myeloid leukemia
    102189930 (BAD)
   05218 Melanoma
    102189930 (BAD)
   05211 Renal cell carcinoma
    102189930 (BAD)
   05215 Prostate cancer
    102189930 (BAD)
   05213 Endometrial cancer
    102189930 (BAD)
   05223 Non-small cell lung cancer
    102189930 (BAD)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102189930 (BAD)
   05014 Amyotrophic lateral sclerosis
    102189930 (BAD)
   05020 Prion disease
    102189930 (BAD)
   05022 Pathways of neurodegeneration - multiple diseases
    102189930 (BAD)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102189930 (BAD)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102189930 (BAD)
   05161 Hepatitis B
    102189930 (BAD)
   05160 Hepatitis C
    102189930 (BAD)
   05162 Measles
    102189930 (BAD)
   05168 Herpes simplex virus 1 infection
    102189930 (BAD)
   05165 Human papillomavirus infection
    102189930 (BAD)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102189930 (BAD)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102189930 (BAD)
   01524 Platinum drug resistance
    102189930 (BAD)
   01522 Endocrine resistance
    102189930 (BAD)
SSDB
Motif
Pfam: Bcl-2_BAD Bclx_interact
Other DBs
NCBI-GeneID: 102189930
NCBI-ProteinID: XP_017898279
LinkDB
Position
29
AA seq 168 aa
MFQIPEFEQSEQEDSSPADRGLGPSPTGDRPPGLSKHWLTAPGLLGEAGHQQGQPAGSSH
HGGTGAVETRSRHSSYPAGPEDDEGTEEEDLGPFRGRSRSAPPNLWAAQRYGRELRRMSD
EFHVSFKGLPRPKSAGTATQMRQSPSWTRFLQSWLSRNLGRGGSAPSQ
NT seq 507 nt   +upstreamnt  +downstreamnt
atgttccagatcccagagtttgagcagagtgagcaggaagactccagccctgcagatagg
ggcctgggccccagccccacaggggacaggcccccaggtctcagcaagcactggctaaca
gccccgggcctcctgggggaagctggtcaccagcaggggcagccggccggcagcagccac
catggaggcactggggctgtggagacccggagtcgtcacagctcctaccccgcggggcca
gaggatgatgaagggacggaggaggaggatctcggcccctttaggggccgctcgcgttcg
gcgccccccaacctctgggctgcacagcgatatggccgcgagctccgaaggatgagcgac
gagtttcacgtctccttcaaggggcttcctcgcccgaagagcgcgggaacggcaacgcaa
atgcgacaaagccctagctggacgcgcttcctccagtcctggttgagccggaacttgggg
aggggaggctccgccccctcccagtga

DBGET integrated database retrieval system