KEGG   Capra hircus (goat): 102189950
Entry
102189950         CDS       T02910                                 

Gene name
GNAQ
Definition
(RefSeq) guanine nucleotide-binding protein G(q) subunit alpha
  KO
K04634  guanine nucleotide-binding protein G(q) subunit alpha
Organism
chx  Capra hircus (goat)
Pathway
chx04015  Rap1 signaling pathway
chx04020  Calcium signaling pathway
chx04022  cGMP-PKG signaling pathway
chx04062  Chemokine signaling pathway
chx04071  Sphingolipid signaling pathway
chx04261  Adrenergic signaling in cardiomyocytes
chx04270  Vascular smooth muscle contraction
chx04371  Apelin signaling pathway
chx04540  Gap junction
chx04611  Platelet activation
chx04713  Circadian entrainment
chx04720  Long-term potentiation
chx04723  Retrograde endocannabinoid signaling
chx04724  Glutamatergic synapse
chx04725  Cholinergic synapse
chx04726  Serotonergic synapse
chx04728  Dopaminergic synapse
chx04730  Long-term depression
chx04750  Inflammatory mediator regulation of TRP channels
chx04911  Insulin secretion
chx04912  GnRH signaling pathway
chx04915  Estrogen signaling pathway
chx04916  Melanogenesis
chx04918  Thyroid hormone synthesis
chx04921  Oxytocin signaling pathway
chx04922  Glucagon signaling pathway
chx04924  Renin secretion
chx04925  Aldosterone synthesis and secretion
chx04927  Cortisol synthesis and secretion
chx04928  Parathyroid hormone synthesis, secretion and action
chx04929  GnRH secretion
chx04934  Cushing syndrome
chx04935  Growth hormone synthesis, secretion and action
chx04961  Endocrine and other factor-regulated calcium reabsorption
chx04970  Salivary secretion
chx04971  Gastric acid secretion
chx04972  Pancreatic secretion
chx05010  Alzheimer disease
chx05016  Huntington disease
chx05017  Spinocerebellar ataxia
chx05022  Pathways of neurodegeneration - multiple diseases
chx05135  Yersinia infection
chx05142  Chagas disease
chx05143  African trypanosomiasis
chx05146  Amoebiasis
chx05163  Human cytomegalovirus infection
chx05170  Human immunodeficiency virus 1 infection
chx05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102189950 (GNAQ)
   04371 Apelin signaling pathway
    102189950 (GNAQ)
   04020 Calcium signaling pathway
    102189950 (GNAQ)
   04071 Sphingolipid signaling pathway
    102189950 (GNAQ)
   04022 cGMP-PKG signaling pathway
    102189950 (GNAQ)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102189950 (GNAQ)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102189950 (GNAQ)
   04062 Chemokine signaling pathway
    102189950 (GNAQ)
  09152 Endocrine system
   04911 Insulin secretion
    102189950 (GNAQ)
   04922 Glucagon signaling pathway
    102189950 (GNAQ)
   04929 GnRH secretion
    102189950 (GNAQ)
   04912 GnRH signaling pathway
    102189950 (GNAQ)
   04915 Estrogen signaling pathway
    102189950 (GNAQ)
   04921 Oxytocin signaling pathway
    102189950 (GNAQ)
   04935 Growth hormone synthesis, secretion and action
    102189950 (GNAQ)
   04918 Thyroid hormone synthesis
    102189950 (GNAQ)
   04928 Parathyroid hormone synthesis, secretion and action
    102189950 (GNAQ)
   04916 Melanogenesis
    102189950 (GNAQ)
   04924 Renin secretion
    102189950 (GNAQ)
   04925 Aldosterone synthesis and secretion
    102189950 (GNAQ)
   04927 Cortisol synthesis and secretion
    102189950 (GNAQ)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102189950 (GNAQ)
   04270 Vascular smooth muscle contraction
    102189950 (GNAQ)
  09154 Digestive system
   04970 Salivary secretion
    102189950 (GNAQ)
   04971 Gastric acid secretion
    102189950 (GNAQ)
   04972 Pancreatic secretion
    102189950 (GNAQ)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    102189950 (GNAQ)
  09156 Nervous system
   04724 Glutamatergic synapse
    102189950 (GNAQ)
   04725 Cholinergic synapse
    102189950 (GNAQ)
   04728 Dopaminergic synapse
    102189950 (GNAQ)
   04726 Serotonergic synapse
    102189950 (GNAQ)
   04720 Long-term potentiation
    102189950 (GNAQ)
   04730 Long-term depression
    102189950 (GNAQ)
   04723 Retrograde endocannabinoid signaling
    102189950 (GNAQ)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102189950 (GNAQ)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102189950 (GNAQ)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102189950 (GNAQ)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102189950 (GNAQ)
   05016 Huntington disease
    102189950 (GNAQ)
   05017 Spinocerebellar ataxia
    102189950 (GNAQ)
   05022 Pathways of neurodegeneration - multiple diseases
    102189950 (GNAQ)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102189950 (GNAQ)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102189950 (GNAQ)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102189950 (GNAQ)
   05163 Human cytomegalovirus infection
    102189950 (GNAQ)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102189950 (GNAQ)
   05142 Chagas disease
    102189950 (GNAQ)
   05143 African trypanosomiasis
    102189950 (GNAQ)
Exosome [BR:chx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102189950 (GNAQ)
GTP-binding proteins [BR:chx04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 3 (Gq/11) [OT]
    102189950 (GNAQ)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA TniB AAA_29
Other DBs
NCBI-GeneID: 102189950
NCBI-ProteinID: XP_017907582
UniProt: A0A452E831
LinkDB
Position
8
AA seq 359 aa
MTLESIMACCLSEEAKEARRINDEIERQLRRDKRDARRELKLLLLGTGESGKSTFIKQMR
IIHGSGYSDEDKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEK
VSAFENPYVDAIKSLWNDPGIQECYDRRREYQLSDSTKYYLNDLDRVADPAYLPTQQDVL
RVRVPTTGIIEYPFDLQSVIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLV
ESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGPQR
DAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYNLV
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgactctggagtccatcatggcgtgctgcctgagcgaggaggccaaggaagcccggcgg
atcaacgacgagattgagcggcagctccgcagggacaagagggacgcccgccgggagctc
aagctgctgctgctcgggacaggagagagtggcaagagtacatttatcaagcagatgaga
atcatccatgggtcgggctactctgatgaagacaaaaggggcttcaccaagctggtgtat
cagaacatcttcacggccatgcaggctatgatcagagccatggacacgctcaagatcccc
tacaagtacgagcacaataaggctcatgcacagttagttcgagaagttgatgtggagaag
gtatctgcatttgagaatccatatgtagatgcaataaagagtttatggaatgatcctgga
atccaggaatgctatgacagacgacgagaatatcagttatctgactctaccaaatactat
cttaatgacttggaccgcgttgccgaccctgcctacctgcctacgcaacaagatgtgctc
agagttcgagtccccaccacagggatcatcgaataccccttcgatttacaaagtgtcatt
ttcagaatggtcgatgtagggggccagaggtcagagagaagaaaatggatacactgcttt
gaaaacgtcacctctatcatgtttctagtagcgcttagtgaatatgatcaagttctcgtg
gagtcagacaatgagaaccgaatggaggaaagcaaagcactctttagaacaattatcacg
tatccctggttccagaactcctcagttattctgttcttaaacaagaaagatcttctagag
gagaaaattatgtattcccacctagttgactatttcccggaatacgatggaccccagcga
gatgcccaggcagctcgagaattcatcctgaagatgttcgtggacctgaacccagacagt
gacaaaatcatctactcacacttcacatgcgccacagacaccgagaacatccgctttgtg
tttgctgctgtcaaggacaccatcctccagttgaacctgaaggagtacaatctggtctaa

DBGET integrated database retrieval system