KEGG   Capra hircus (goat): 102190144Help
Entry
102190144         CDS       T02910                                 

Gene name
PFKP
Definition
(RefSeq) phosphofructokinase, platelet
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
chx  Capra hircus (goat)
Pathway
chx00010  Glycolysis / Gluconeogenesis
chx00030  Pentose phosphate pathway
chx00051  Fructose and mannose metabolism
chx00052  Galactose metabolism
chx01100  Metabolic pathways
chx01200  Carbon metabolism
chx01230  Biosynthesis of amino acids
chx03018  RNA degradation
chx04152  AMPK signaling pathway
chx05230  Central carbon metabolism in cancer
Module
chx_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:chx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102190144 (PFKP)
   00030 Pentose phosphate pathway
    102190144 (PFKP)
   00051 Fructose and mannose metabolism
    102190144 (PFKP)
   00052 Galactose metabolism
    102190144 (PFKP)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    102190144 (PFKP)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    102190144 (PFKP)
 09160 Human Diseases
  09161 Cancers: Overview
   05230 Central carbon metabolism in cancer
    102190144 (PFKP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:chx01009]
    102190144 (PFKP)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:chx03019]
    102190144 (PFKP)
Enzymes [BR:chx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     102190144 (PFKP)
Protein phosphatases and associated proteins [BR:chx01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102190144 (PFKP)
Messenger RNA biogenesis [BR:chx03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     102190144 (PFKP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 102190144
NCBI-ProteinID: XP_017912825
LinkDB All DBs
Position
13
AA seq 791 aa AA seqDB search
MDGHDSPQTPKGSFRKFLEQLSGAGKAIGVLTSGGDAQGMNAAVRAVVRMGIYVGAKVYF
IYEGYQGMVDGGSNIVEANWESVSSILQVGGTIIGSARCQDFRTREGRLKAACNLVQLGI
TSLCVIGGDGSLTGAHIFQTEWSGLLEELAHDGKISAEQVQKHGHLNVVGMVGSIDNDFC
GTDMTIGTDSALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFL
PESPPEEGWQENMCIKLSENRARKKRLNIIIVAEGAIDTQNKPITSEQIKELVVTQLGYD
TRVTILGHVQRGGTPSAFDRILASRMGVEAVVALLQATPETPACVVSLSGNQAVRLPLME
CVQMTQEVQKAMDERRFKDAVQLRGRSFENNLNTYKRLAIKLPDSEIPKSNCNVGVVNVG
APAAGMNAAVRAAVRVGISEGHKMFAVYDGFEGFAKGQIKEIGWGDVGGWTGQGGSILGT
KRILPGKYLEDIAAQMRTHGISALLIIGGFEAYLGLLELLAARQKHEEFCVPMVMVPATV
SNNVPGSDFSIGADTALNTITDTCDRIKQSASGTKRRVFIIETMGGFCGYLANMGGLAAG
ADAAYIFEEPFDIRDLQSNVEHLTEKMKTSIQRGLVLRNESCSENYTTDFIYQLYSEEGK
GVFDCRKNVLGHMQQGGAPSPFDRNFGTKISARAMQWISSKLRESAGKGKKFLSEDSVCV
LGISKRTLLFQPVAELKKETDFEHRIPKEQWWLKLRPLMKILAKYKVSFEVSDASQLEPV
QPRGAEEPAAI
NT seq 2376 nt NT seq  +upstreamnt  +downstreamnt
atggacggccacgacagccctcagacccccaagggctccttccgaaagttcctggagcaa
ctctccggggccggcaaggccatcggcgtgctgaccagcggcggggatgcccaaggcatg
aatgctgctgtccgggccgtcgtgcgcatggggatatacgtgggcgccaaggtgtacttc
atctatgagggctaccagggcatggtggatggcggcagcaacattgtggaagccaactgg
gagagcgtctccagcatcctacaagtgggagggaccatcatcggcagtgcccgctgccag
gacttccgtactcgggaaggccgcctgaaggccgcatgtaacttggttcagctgggcatc
accagcctgtgtgtgatcggcggggatggcagcctcaccggggcccacatcttccagacg
gagtggagcgggctgctggaagagctggcccatgacggcaagatcagcgcggagcaggtg
cagaagcacgggcacctcaatgtggtgggaatggtgggctccatcgacaacgacttctgc
ggcaccgacatgaccatcggcacagactcggccctacaccgcatcatcgaggtggtggac
gccatcatgacaactgcccagagccaccagcggaccttcgtcctggaggtgatggggaga
cattgcgggtacctggccctggtgagcgctctggcctgcggggccgactgggtcttcctt
cccgagtccccaccggaggaaggctggcaggaaaacatgtgcatcaagctctcagagaac
cgtgcccggaagaaaaggttgaacatcatcattgtggccgaaggggccatcgacacccag
aacaagcccatcacctcggagcagatcaaggagctcgtggtcacgcagctgggctacgac
acgcgagtgaccatccttggacacgtgcagagaggcgggacgccgtcagcttttgacagg
attctggccagccgcatgggggtggaggctgtggtcgccctcctgcaggccactcccgag
actccggcctgtgtggtgtcgctgagcgggaaccaggcagtgcgactgccgctgatggag
tgtgtacagatgacccaggaggtacaaaaggcgatggatgagaggagatttaaggatgcc
gtgcaactccgaggaaggagcttcgagaacaacctcaacacctacaagcggctggccatc
aagctgccagactctgaaatcccaaagagcaactgcaatgtgggcgtcgtgaacgtgggt
gcgcccgcggctggcatgaatgcggccgtgcgcgccgctgtgcgcgtgggcatctctgaa
ggacacaagatgtttgctgtgtatgacggcttcgagggcttcgccaaaggccagataaag
gaaatcggctggggggacgttggaggctggacgggccaaggtggctccatccttgggaca
aaacgcatcctccctgggaaatacctggaggacatcgcggcgcagatgcgaacccatggc
atcagcgctctcttgattatcggtggatttgaggcctacctggggctgctggagctgttg
gccgcccggcagaagcacgaggagttctgtgtccccatggtcatggtccccgccaccgtc
tccaacaacgtgcccggctccgacttcagcatcggggcggacaccgccctcaacaccatc
accgacacgtgcgaccgcatcaagcagtcggccagcgggaccaagcggcgcgtgttcatc
atcgagaccatggggggcttctgcggctacctggccaacatggggggactggcggctggt
gcagacgctgcctacatctttgaggagcctttcgacatccgggacctgcagtccaacgtg
gagcacctgacagagaagatgaagaccagcatccagagggggctcgtgctcaggaacgag
agctgcagcgagaactacaccaccgacttcatctaccagctctactccgaggagggcaag
ggcgtgttcgactgcaggaagaacgtgctgggccacatgcagcagggtggggcaccttct
ccgttcgacagaaactttggaaccaaaatttccgccagagccatgcagtggatcagctcg
aagctgagggagtctgcggggaaaggaaaaaaatttttaagtgaggactctgtgtgtgtg
ctgggaatcagcaagagaacactgctgttccagcccgtggcggagctgaagaaggagaca
gactttgagcaccggatccccaaggagcagtggtggttgaagctgcggcccctcatgaag
atcctggccaagtacaaggtcagcttcgaggtgtcagatgccagccagctggagcctgtg
cagccccgtggcgctgaggagccggccgccatctag

DBGET integrated database retrieval system