KEGG   Capra hircus (goat): 102190301
Entry
102190301         CDS       T02910                                 

Gene name
STAT2
Definition
(RefSeq) signal transducer and activator of transcription 2
  KO
K11221  signal transducer and activator of transcription 2
Organism
chx  Capra hircus (goat)
Pathway
chx04062  Chemokine signaling pathway
chx04217  Necroptosis
chx04380  Osteoclast differentiation
chx04621  NOD-like receptor signaling pathway
chx04625  C-type lectin receptor signaling pathway
chx04630  JAK-STAT signaling pathway
chx05160  Hepatitis C
chx05161  Hepatitis B
chx05162  Measles
chx05164  Influenza A
chx05165  Human papillomavirus infection
chx05167  Kaposi sarcoma-associated herpesvirus infection
chx05168  Herpes simplex virus 1 infection
chx05169  Epstein-Barr virus infection
chx05171  Coronavirus disease - COVID-19
chx05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102190301 (STAT2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102190301 (STAT2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    102190301 (STAT2)
   04625 C-type lectin receptor signaling pathway
    102190301 (STAT2)
   04062 Chemokine signaling pathway
    102190301 (STAT2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102190301 (STAT2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102190301 (STAT2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    102190301 (STAT2)
   05160 Hepatitis C
    102190301 (STAT2)
   05171 Coronavirus disease - COVID-19
    102190301 (STAT2)
   05164 Influenza A
    102190301 (STAT2)
   05162 Measles
    102190301 (STAT2)
   05168 Herpes simplex virus 1 infection
    102190301 (STAT2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102190301 (STAT2)
   05169 Epstein-Barr virus infection
    102190301 (STAT2)
   05165 Human papillomavirus infection
    102190301 (STAT2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:chx03000]
    102190301 (STAT2)
Transcription factors [BR:chx03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    102190301 (STAT2)
SSDB
Motif
Pfam: STAT_alpha STAT2_C STAT_bind STAT_int SH2 CC2-LZ
Other DBs
NCBI-GeneID: 102190301
NCBI-ProteinID: XP_017903558
UniProt: A0A452ET77
LinkDB
Position
5
AA seq 851 aa
MAQWEMLQNLDSPFQDQLHELYSNSLLPMDVRQHLAVWIEDQNWQEAALGNDAAMANMLF
FHFLDQLNSECGRCSQDSEYFLLQHNLRKFYRDIQALPTGSTQLAEMIFNLLLEEKRILT
WAQRAQLEQQEPAPEAPGESQQHELDSRILKLQAMKEKLVKSISQLKDQQDVFCFRYNIE
KSARTASLDPRQTRQMNILQETLNELDRQRKEVLDASKALLGQLTTLIELLLPKLEEWKV
QQQKACIGAPPVGGLEQLEKWFTDGAKLLFHLRQLLKELKELSHMVSYQGDPLNEGVDLR
EAQVTELLQRLLHRAFVVESQPCMPQTLHRPLILKTGSKFTVRTRLLVRLQEGNESLTAE
VSVDRKSPKSQGFRKFNILTSNQKTLTPEKGQTQGLIWDFGYLTLVEQRSGGSGKGNSKG
PLSVTEELHIISFTVKYTFQGLKQELTTDTLPVVIISNMNQLSIAWASVLWFNLLSSNPQ
DQQFFSNPPKAPWNLLGPALSWQFSSYVNRGLDSDQLGMLRDKLFGQNSKTEGLSWVDFI
KRESPPGKLPFWTWLDKILDLIHDHLKDLWKDGRIMGFVSRNQVRRLLKKTVSGTFLLRF
SETLEGGITCSWVEHQDDDEVLINSVQPFTKEVLQSLPLTKIISQYQMLTEENIPENPLR
FLYPRIPRDEAFGCYSQEKINPEERKKYLKHKLIFVSNRQVDELQQLPELKLEPELESLG
FTSGPEHGPGLDLEPLLEAGLDLSLEPTLERMLERTLGEVSQGVLEPHPGPQLQLEPIPE
LDVQAMPEPDLPYDLRHLNTEDMEIFRNSMRIEEIMPNGDPLLPCQNTMDEADVFSPSHF
YADGPLSPSDY
NT seq 2556 nt   +upstreamnt  +downstreamnt
atggcgcagtgggagatgctgcagaaccttgacagcccgtttcaggatcagctgcatgag
ctctactcaaatagcctcctgccaatggatgttcgacagcacttggctgtctggattgaa
gatcagaactggcaggaagctgcactggggaacgatgctgctatggctaatatgctattc
ttccacttcttggaccaactcaactctgagtgtggccgatgcagccaagactctgagtat
tttttgctacagcacaacttgcgaaaattctatcgggacattcaggcccttcccactggc
tctacccagttggctgagatgatctttaatctccttctggaagaaaaaagaattctgacc
tgggctcagagggctcagctggagcaacaagagccagcccctgaagcacctggggagagc
cagcagcatgaacttgattcccggatcctgaaattacaggctatgaaggagaagctggtg
aaatccatcagccaactgaaagaccagcaggatgtcttctgtttccgatataatatcgag
aaatcagcgaggactgcttctctggacccccgtcagaccagacagatgaacattcttcag
gaaacactcaatgaactggacagacagagaaaggaggtgctggatgcctccaaagcactg
ctaggccagttaactaccttaattgagctattgctgcccaagttggaggaatggaaagtc
cagcagcagaaggcctgcattggagcgccccctgtcggagggttggaacagctggagaag
tggttcacagatggagcgaagctgttgtttcacctgcggcagctgctgaaggagctgaag
gagttgagtcacatggtctcctatcagggggaccctctgaacgaaggggtggacctgcgg
gaggcgcaggtcacagagctgctgcagcgcctgcttcacagagcctttgtagtagaaagt
cagccctgcatgccccaaactcttcatcgacccctcatcctcaagacagggagcaagttc
accgtccgaacaaggctgctagtgagactccaggaaggcaatgaatcactgactgcggaa
gtctccgttgacaggaagtctcccaagtcacaaggcttccggaagttcaacattttgacc
tcaaaccagaaaactttgacccccgagaaaggccagactcagggcttaatttgggacttc
ggctacctgactctggtggagcaacgttcagggggttcaggaaaaggcaacagtaagggg
ccgctgtccgttacagaggaattgcacatcattagcttcacagtcaaatacaccttccag
ggtctgaagcaggagctgacaacggacaccctccctgtggtgattatttctaacatgaac
caactctcaattgcctgggcctctgttctctggttcaatctgctcagctcaaacccccag
gatcagcagttcttctccaaccccccgaaggccccatggaacttgctgggccctgctctc
agctggcaattctcctcctatgttaatcgaggcctcgactcagaccagctaggcatgctg
agggacaagctgtttgggcagaactccaagactgaagggttgtcctgggttgacttcatt
aagcgagagagtccccctggcaagctaccgttttggacatggctcgacaagattctggac
ctgatacatgaccacctgaaggatctctggaaggatggacgtatcatgggctttgtgagc
cggaaccaggtgcgccggctgctgaagaagactgtctctggcaccttcctgctgcgcttc
agtgaaacgttggaggggggcattacctgctcctgggtggaacaccaagatgatgacgag
gtgctcatcaactctgtgcagcccttcaccaaggaggtgctgcagtcactcccactgacc
aagatcatcagccagtaccagatgctcacggaggagaacatacctgagaacccactgcgc
ttcctctacccgcgaatcccccgggatgaggcttttggttgctactcccaggagaaaatt
aatcctgaggagcggaagaaatacctgaaacataagctcatttttgtctctaacagacag
gtggatgagctgcagcaactgccggagctcaagttggagccagagctggagtcattaggg
ttcacatcagggcctgagcacgggccaggcctggacttagagccactgctggaggcagga
ttggatctgagcctggagcccacgctggagcgcatgctggagcgcacactaggcgaggtg
tcacagggagtcctagaaccacatccaggaccacaactgcagctggagcctattccagag
ctcgatgtacaggccatgccagaaccagatttgccctatgatctgagacacttgaacact
gaggacatggaaatctttaggaacagcatgaggattgaagaaatcatgccaaacggtgat
ccactattgccttgccagaacaccatggatgaagctgacgtcttcagccccagccacttc
tatgcagatgggcccttgagcccttctgactactag

DBGET integrated database retrieval system