KEGG   Capra hircus (goat): 102190507
Entry
102190507         CDS       T02910                                 

Gene name
IL3
Definition
(RefSeq) interleukin-3
  KO
K04736  interleukin 3
Organism
chx  Capra hircus (goat)
Pathway
chx04060  Cytokine-cytokine receptor interaction
chx04151  PI3K-Akt signaling pathway
chx04210  Apoptosis
chx04630  JAK-STAT signaling pathway
chx04640  Hematopoietic cell lineage
chx04664  Fc epsilon RI signaling pathway
chx05200  Pathways in cancer
chx05202  Transcriptional misregulation in cancer
chx05221  Acute myeloid leukemia
chx05310  Asthma
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102190507 (IL3)
   04151 PI3K-Akt signaling pathway
    102190507 (IL3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102190507 (IL3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102190507 (IL3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102190507 (IL3)
   04664 Fc epsilon RI signaling pathway
    102190507 (IL3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102190507 (IL3)
   05202 Transcriptional misregulation in cancer
    102190507 (IL3)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    102190507 (IL3)
  09163 Immune disease
   05310 Asthma
    102190507 (IL3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:chx04052]
    102190507 (IL3)
   00536 Glycosaminoglycan binding proteins [BR:chx00536]
    102190507 (IL3)
Cytokines and growth factors [BR:chx04052]
 Cytokines
  Interleukins
   102190507 (IL3)
Glycosaminoglycan binding proteins [BR:chx00536]
 Heparan sulfate / Haparin
  Cytokines
   102190507 (IL3)
SSDB
Motif
Pfam: IL3
Other DBs
NCBI-GeneID: 102190507
NCBI-ProteinID: XP_005682685
LinkDB
Position
7
AA seq 139 aa
MSSLSILHLLLLLLALHAPQAQGLPLRTSRTPYSSLMEEIMDDLKKITPSPEGSLNSDEK
NILANKSLLQANLKAFMTFATDTFGNDSKIMKNLKEFQPVLPTATPTEDSILIEDSNLGD
FRMKLEEYLATIRGYLRHD
NT seq 420 nt   +upstreamnt  +downstreamnt
atgagcagcctctctatcttgcatctgctcctgctcctgcttgcactccatgcccctcag
gcacaggggctgcctttgaggacatcgaggactccatattctagcttgatggaggaaatt
atggatgacctaaagaaaataactccgagtccagaaggctccttgaactcagatgagaag
aatatcctggcgaataagagccttctgcaggcaaacctgaaagcgttcatgacatttgcc
acagatacttttggaaatgattcaaaaatcatgaaaaatcttaaggaattccagccagtg
ctgcccacagccacacccacggaagattcaattcttattgaggacagcaacttgggggat
tttcggatgaaattggaagaatatttggctaccattagaggctatctcagacacgactga

DBGET integrated database retrieval system