KEGG   Capra hircus (goat): 102190519
Entry
102190519         CDS       T02910                                 

Gene name
ATG12
Definition
(RefSeq) autophagy related 12
  KO
K08336  ubiquitin-like protein ATG12
Organism
chx  Capra hircus (goat)
Pathway
chx04068  FoxO signaling pathway
chx04136  Autophagy - other
chx04140  Autophagy - animal
chx04621  NOD-like receptor signaling pathway
chx04622  RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    102190519 (ATG12)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102190519 (ATG12)
   04136 Autophagy - other
    102190519 (ATG12)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    102190519 (ATG12)
   04622 RIG-I-like receptor signaling pathway
    102190519 (ATG12)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:chx04131]
    102190519 (ATG12)
   04121 Ubiquitin system [BR:chx04121]
    102190519 (ATG12)
   03029 Mitochondrial biogenesis [BR:chx03029]
    102190519 (ATG12)
Membrane trafficking [BR:chx04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    102190519 (ATG12)
Ubiquitin system [BR:chx04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   102190519 (ATG12)
Mitochondrial biogenesis [BR:chx03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    102190519 (ATG12)
SSDB
Motif
Pfam: APG12 Atg8
Other DBs
NCBI-GeneID: 102190519
NCBI-ProteinID: XP_005685101
UniProt: A0A452FY60
LinkDB
Position
10
AA seq 140 aa
MAEEQESALLLPPSAAPEAEVPAEVSPETATPEPPSSAAVSPGTEEPVGDTKKKIDILLK
AVGDTPIMKTKKWAVERTRTIQGLIDFIKKFLKLVASEQLFIYVNQSFAPSPDQEVGTLY
ECFGSDGKLVLHYCKSQAWG
NT seq 423 nt   +upstreamnt  +downstreamnt
atggctgaggagcaagagtctgcgctgctgctccctccctcagctgctcccgaagctgaa
gtgcctgccgaggtctccccagaaacagccactccggagcccccttcttctgctgcagtc
tctccgggaacagaggaacctgtcggtgacaccaagaaaaaaattgacattctgctaaag
gctgtgggagacactcctataatgaaaacaaagaaatgggctgtggagcgaacccgaacc
atccaaggactcattgacttcatcaaaaagttccttaaacttgtggcttcggaacagttg
tttatttacgtgaatcagtcctttgccccctccccagaccaggaagttgggaccctctat
gagtgttttggcagtgatggtaaactggtcctgcattactgcaaatctcaagcatgggga
tga

DBGET integrated database retrieval system