KEGG   Capra hircus (goat): 102190646Help
Entry
102190646         CDS       T02910                                 

Gene name
GAD1
Definition
(RefSeq) glutamate decarboxylase 1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
chx  Capra hircus (goat)
Pathway
chx00250  Alanine, aspartate and glutamate metabolism
chx00410  beta-Alanine metabolism
chx00430  Taurine and hypotaurine metabolism
chx00650  Butanoate metabolism
chx01100  Metabolic pathways
chx04727  GABAergic synapse
chx04940  Type I diabetes mellitus
Module
chx_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:chx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    102190646 (GAD1)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    102190646 (GAD1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    102190646 (GAD1)
   00430 Taurine and hypotaurine metabolism
    102190646 (GAD1)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    102190646 (GAD1)
 09160 Human Diseases
  09166 Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    102190646 (GAD1)
Enzymes [BR:chx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     102190646 (GAD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase DegT_DnrJ_EryC1 SepSecS OKR_DC_1 Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 102190646
NCBI-ProteinID: XP_017919967
LinkDB All DBs
Position
2
AA seq 594 aa AA seqDB search
MASSTPSSSATSSNAGVDPNTTNLRPTTYDTWCGVAHGCTRKLGLKICGFLQRTNSLEEK
SRLVSAFKERQSSKNLLSCENSDKDGRFRRTETDFSNLFARDLLPAKNGEEQTVQFLLEV
VDILLNYVRKTFDRSTKVLDFHHPHQLLEGMEGFNLELSDHPESLEQILVDCRDTLKYGV
RTGHPRFFNQLSTGLDIIGLAGEWLTSTANTNMFTYEIAPVFVLMEQITLKKMREIVGWS
SKDGDGIFSPGGAISNMYSIMAARFKYFPEVKTKGMAAVPKLVLFTSEHSHYSIKKAGAA
LGFGTDNVILIKCNERGKIIPADLETKILEAKQKGYIPLYVNATAGTTVYGAFDPIQEIA
DICEKYNLWLHVDAAWGGGLLMSQKHRHKLSGIERANSVTWNPHKMMGVLLQCSAILVKE
KGILQGCNQMCAGYLFQPDKQYDVSYDTGDKAIQCGRHVDIFKFWLMWKAKGTVGFENQI
NKCLELAEYLYAKIKNREEFEMVFDGEPEHTNVCFWYIPQSLRGVPDSPERREKLHRVAP
KIKALMMESGTTMVGYQPQGDKANFFRMVISNPAATQSDIDFLIEEIERLGQDL
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcttcgaccccttcttcgtccgcaacctcctcgaacgcgggagtggaccccaat
actaccaacctgcgccccacaacgtatgacacctggtgcggcgtggcccatggatgcacc
agaaaactggggctgaagatctgcggcttcttgcagaggaccaacagcctggaagagaag
agcaggcttgtgagcgccttcaaggagaggcagtcctccaagaacctgctttcctgtgaa
aacagtgacaaggatggccgcttccgacgcacggagacagacttctccaacctgttcgcc
cgagatctgcttccggctaagaacggggaggagcaaactgtgcagttcctgttggaggtg
gtggacatactcctcaactatgtccggaagacgttcgatcgctccacgaaagtgctggac
ttccaccacccccaccagctgctggaaggcatggagggcttcaacttggaactctctgac
caccccgagtccctggagcagatcctggttgactgcagagacaccctgaaatatggggtc
cgcacaggtcatcctcgatttttcaaccagctctccacaggattggatatcattggttta
gctggcgagtggctgacatcaactgccaataccaatatgtttacatatgaaattgcacca
gtgtttgtcctcatggagcaaataacacttaagaagatgagagagatagttggatggtca
agtaaagatggtgatgggatattttctcctgggggagccatatccaacatgtacagcatc
atggctgctcgcttcaagtacttcccagaagttaagaccaagggtatggcggctgtgccc
aagcttgtcctcttcacctcagaacacagtcactattccataaagaaagctggggctgcc
cttggctttggaaccgacaatgtgattttgataaagtgcaatgaaagggggaagataatt
ccagctgatttagagacaaaaattcttgaagccaagcaaaagggttacatccctctgtac
gtcaatgcaactgctggcaccactgtttatggcgcttttgatccaatacaggagattgca
gatatatgtgagaaatacaacctttggctgcatgtcgatgctgcctggggcggcgggctg
ctcatgtcccagaagcaccgtcataaactcagtggcatcgagagggccaactctgtcacc
tggaaccctcacaagatgatgggtgtgctgctgcagtgctctgccattcttgtaaaagaa
aagggtatcctccaaggatgcaaccagatgtgtgcgggatacctcttccagccagacaag
cagtatgatgtctcctatgacactggggacaaggccattcagtgcggccgccacgtagac
atcttcaagttctggctgatgtggaaagcaaagggtacagtgggctttgaaaatcagatc
aacaaatgcttggaactggctgaatacctctatgccaagattaaaaacagagaagaattt
gagatggtttttgatggtgagcctgagcatacgaacgtctgtttctggtatattccacaa
agcctcaggggtgttccggatagccctgaacgacgggaaaagctacacagggtggccccg
aaaatcaaagccctgatgatggaatctggcacaaccatggttggctaccagcctcagggg
gacaaggccaacttcttccggatggtcatctccaacccagccgctacccaatctgatatt
gacttcctgattgaggagatagagaggctgggccaggatctgtaa

DBGET integrated database retrieval system