KEGG   Capra hircus (goat): 102191154
Entry
102191154         CDS       T02910                                 

Gene name
CD3D
Definition
(RefSeq) CD3d molecule
  KO
K06450  T-cell surface glycoprotein CD3 delta chain
Organism
chx  Capra hircus (goat)
Pathway
chx04640  Hematopoietic cell lineage
chx04658  Th1 and Th2 cell differentiation
chx04659  Th17 cell differentiation
chx04660  T cell receptor signaling pathway
chx05142  Chagas disease
chx05162  Measles
chx05166  Human T-cell leukemia virus 1 infection
chx05169  Epstein-Barr virus infection
chx05170  Human immunodeficiency virus 1 infection
chx05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
chx05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:chx00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102191154 (CD3D)
   04660 T cell receptor signaling pathway
    102191154 (CD3D)
   04658 Th1 and Th2 cell differentiation
    102191154 (CD3D)
   04659 Th17 cell differentiation
    102191154 (CD3D)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102191154 (CD3D)
  09163 Immune disease
   05340 Primary immunodeficiency
    102191154 (CD3D)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102191154 (CD3D)
   05170 Human immunodeficiency virus 1 infection
    102191154 (CD3D)
   05162 Measles
    102191154 (CD3D)
   05169 Epstein-Barr virus infection
    102191154 (CD3D)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    102191154 (CD3D)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:chx04090]
    102191154 (CD3D)
CD molecules [BR:chx04090]
 Proteins
  102191154 (CD3D)
SSDB
Motif
Pfam: Ig_4 ITAM Ig_5
Other DBs
NCBI-GeneID: 102191154
NCBI-ProteinID: XP_005689567
UniProt: A0A452DT34
LinkDB
Position
15
AA seq 167 aa
MEHSRCLSCLILAALLSQVNPRVLEVQEPEDKVILKCNSSITLLQGTAGQEVSDNKTLDL
GKRIEDPRGMYQCGENAKSFTLQVYYRMCQNCVELDSATLAGLIITDIIATVLLALGVYC
FAGHETGRFSRAADTQVLMGNDQLYQPLRERNDAQYSRLGDKWARNK
NT seq 504 nt   +upstreamnt  +downstreamnt
atggagcacagcagatgtctctcttgcctgatactggctgcccttctctcccaagtgaat
ccccgtgttctagaagtgcaggaacctgaggacaaagtaattttgaaatgcaattccagc
atcacattgctacaaggaacagcaggacaagaagtgtcagacaataaaactctggattta
ggaaaacgtattgaggacccaagaggaatgtatcagtgcggtgaaaacgccaaatcattt
actctgcaagtatactatcgaatgtgccagaactgtgtggagctggactcagccaccttg
gcaggcctcatcatcaccgacatcattgccactgtgctccttgctttgggtgtctactgc
tttgctggacatgagactggaagattctccagggctgctgacactcaagttctgatgggg
aatgaccagctctatcagccccttcgagagcgcaatgatgctcagtacagtcgtcttggt
gataagtgggctcggaacaaatga

DBGET integrated database retrieval system