Capra hircus (goat): 102191154 Help Entry 102191154         CDS       T02910                                  Gene name CD3D Definition (RefSeq) CD3d molecule   KO K06450   T-cell surface glycoprotein CD3 delta chain Organism chx  Capra hircus (goat) Pathway chx04640   Hematopoietic cell lineage chx04658   Th1 and Th2 cell differentiation chx04659   Th17 cell differentiation chx04660   T cell receptor signaling pathway chx05142   Chagas disease chx05162   Measles chx05166   Human T-cell leukemia virus 1 infection chx05169   Epstein-Barr virus infection chx05170   Human immunodeficiency virus 1 infection chx05235   PD-L1 expression and PD-1 checkpoint pathway in cancer chx05340   Primary immunodeficiency Brite KEGG Orthology (KO) [BR:chx00001]  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     102191154 (CD3D)    04660 T cell receptor signaling pathway     102191154 (CD3D)    04658 Th1 and Th2 cell differentiation     102191154 (CD3D)    04659 Th17 cell differentiation     102191154 (CD3D)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     102191154 (CD3D)   09163 Immune disease    05340 Primary immunodeficiency     102191154 (CD3D)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102191154 (CD3D)    05170 Human immunodeficiency virus 1 infection     102191154 (CD3D)    05162 Measles     102191154 (CD3D)    05169 Epstein-Barr virus infection     102191154 (CD3D)   09174 Infectious disease: parasitic    05142 Chagas disease     102191154 (CD3D)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04090 CD molecules [BR:chx04090]     102191154 (CD3D) CD molecules [BR:chx04090]  Proteins   102191154 (CD3D) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ig_4 ITAM Ig_5 Motif Other DBs NCBI-GeneID:  102191154 NCBI-ProteinID:  XP_005689567 UniProt:  A0A452DT34 LinkDB All DBs Position 15 AA seq 167 aa AA seqDB search MEHSRCLSCLILAALLSQVNPRVLEVQEPEDKVILKCNSSITLLQGTAGQEVSDNKTLDL GKRIEDPRGMYQCGENAKSFTLQVYYRMCQNCVELDSATLAGLIITDIIATVLLALGVYC FAGHETGRFSRAADTQVLMGNDQLYQPLRERNDAQYSRLGDKWARNK NT seq 504 nt NT seq  +upstreamnt  +downstreamnt atggagcacagcagatgtctctcttgcctgatactggctgcccttctctcccaagtgaat ccccgtgttctagaagtgcaggaacctgaggacaaagtaattttgaaatgcaattccagc atcacattgctacaaggaacagcaggacaagaagtgtcagacaataaaactctggattta ggaaaacgtattgaggacccaagaggaatgtatcagtgcggtgaaaacgccaaatcattt actctgcaagtatactatcgaatgtgccagaactgtgtggagctggactcagccaccttg gcaggcctcatcatcaccgacatcattgccactgtgctccttgctttgggtgtctactgc tttgctggacatgagactggaagattctccagggctgctgacactcaagttctgatgggg aatgaccagctctatcagccccttcgagagcgcaatgatgctcagtacagtcgtcttggt gataagtgggctcggaacaaatga

DBGET integrated database retrieval system