KEGG   Capra hircus (goat): 102191742Help
Entry
102191742         CDS       T02910                                 

Gene name
CTNNB1
Definition
(RefSeq) catenin beta 1
  KO
K02105  catenin beta 1
Organism
chx  Capra hircus (goat)
Pathway
chx04015  Rap1 signaling pathway
chx04310  Wnt signaling pathway
chx04390  Hippo signaling pathway
chx04510  Focal adhesion
chx04520  Adherens junction
chx04550  Signaling pathways regulating pluripotency of stem cells
chx04670  Leukocyte transendothelial migration
chx04916  Melanogenesis
chx04919  Thyroid hormone signaling pathway
chx04934  Cushing syndrome
chx05100  Bacterial invasion of epithelial cells
chx05160  Hepatitis C
chx05163  Human cytomegalovirus infection
chx05165  Human papillomavirus infection
chx05167  Kaposi sarcoma-associated herpesvirus infection
chx05200  Pathways in cancer
chx05205  Proteoglycans in cancer
chx05210  Colorectal cancer
chx05213  Endometrial cancer
chx05215  Prostate cancer
chx05216  Thyroid cancer
chx05217  Basal cell carcinoma
chx05224  Breast cancer
chx05225  Hepatocellular carcinoma
chx05226  Gastric cancer
chx05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
chx05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102191742 (CTNNB1)
   04310 Wnt signaling pathway
    102191742 (CTNNB1)
   04390 Hippo signaling pathway
    102191742 (CTNNB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102191742 (CTNNB1)
   04520 Adherens junction
    102191742 (CTNNB1)
   04550 Signaling pathways regulating pluripotency of stem cells
    102191742 (CTNNB1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    102191742 (CTNNB1)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    102191742 (CTNNB1)
   04916 Melanogenesis
    102191742 (CTNNB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102191742 (CTNNB1)
   05205 Proteoglycans in cancer
    102191742 (CTNNB1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102191742 (CTNNB1)
   05225 Hepatocellular carcinoma
    102191742 (CTNNB1)
   05226 Gastric cancer
    102191742 (CTNNB1)
   05216 Thyroid cancer
    102191742 (CTNNB1)
   05217 Basal cell carcinoma
    102191742 (CTNNB1)
   05215 Prostate cancer
    102191742 (CTNNB1)
   05213 Endometrial cancer
    102191742 (CTNNB1)
   05224 Breast cancer
    102191742 (CTNNB1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102191742 (CTNNB1)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    102191742 (CTNNB1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102191742 (CTNNB1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    102191742 (CTNNB1)
  09172 Infectious disease: viral
   05160 Hepatitis C
    102191742 (CTNNB1)
   05163 Human cytomegalovirus infection
    102191742 (CTNNB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102191742 (CTNNB1)
   05165 Human papillomavirus infection
    102191742 (CTNNB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arm Cnd1 Adaptin_N HEAT_2 HEAT_EZ KAP Atx10homo_assoc Arm_2 Queuosine_synth
Motif
Other DBs
NCBI-GeneID: 102191742
NCBI-ProteinID: XP_017922383
UniProt: A0A2Z4FR65
LinkDB All DBs
Position
22
AA seq 781 aa AA seqDB search
MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTT
QVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPT
NVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSK
KEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPAL
VKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDC
LQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEA
GGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCA
AGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEM
AQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLL
VRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFV
QLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLF
RMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFH
SGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTD
L
NT seq 2346 nt NT seq  +upstreamnt  +downstreamnt
atggctacccaagctgatttgatggagctggacatggccatggagccagacagaaaagca
gccgtcagccactggcagcagcagtcttacctggactctggaatccattctggtgccact
accacagcgccttctctgagcggtaaaggcaatcctgaggaagaggacgtggataccacc
caagtcctgtatgagtgggagcaggggttttctcagtccttcacgcaagaacaagtagct
gatatcgatggacagtatgcaatgactcgagctcagagggtgagagctgctatgttccct
gagacgctagatgagggcatgcagatcccatctacacagttcgatgctgctcatcccact
aacgtccagcgtctggctgaaccatcacagatgctgaaacatgctgttgtaaacttaatt
aactaccaagatgatgcagaacttgccacacgtgcaatccctgaattgacaaaactgctg
aatgacgaagaccaggtggtggttaataaggctgcagttatggtccatcagctttctaaa
aaggaagcttccagacacgccatcatgcgttctcctcagatggtgtctgctattgtacgt
accatgcagaacacaaatgatgtggaaacagctcgctgtactgctgggaccttgcacaat
ctttcccaccatcgtgagggcttgctggccatctttaaatctgggggcattcctgccctg
gtgaagatgcttggttcgccagtggattctgtattgttttatgccattacaactctccac
aaccttttactgcatcaggaaggagctaaaatggcagtgcgtttagctggcgggctgcag
aaaatggttgccttgctcaacaaaacaaatgttaaattcttggctattacaacagactgt
cttcagattttagcttacggcaatcaagaaagcaagctcatcattctggctagtggtgga
cctcaagctctagtgaatataatgaggacctacacttatgagaaactactgtggaccaca
agcagagtgctgaaggtgctgtctgtgtgctctagtaacaagccggctattgtagaagct
ggtggaatgcaagctttaggacttcacctgacagatccaagtcagcgccttgttcagaac
tgcctttggactctaaggaatctttcagatgctgcaactaaacaggaagggatggaaggt
cttcttgggactcttgttcagcttctaggctcagatgatatcaatgtggtcacctgtgca
gctggaattctttctaacctcacttgcaataattataagaacaagatgatggtgtgccaa
gtgggcggcatagaggcccttgtgcgcacggtcctccgtgctggggacagggaagacatc
accgagcctgccatctgtgcccttcgtcatctgaccagccggcaccaggaggctgagatg
gcccagaacgctgttcgccttcactacggactacctgtggtggttaaactcctacatcca
ccatcccactggcctctgatcaaggctactgttggattgattcgaaatcttgccctttgt
ccagcaaatcatgcgcctttgcgtgagcagggtgccattccacgactagttcagttgctg
gttcgtgcacatcaggatacccagcgtcgtacatctatgggtggaacacagcagcagttt
gtggagggagtccgcatggaagaaatagttgaaggttgtactggagcccttcacatccta
gctcgggatgttcacaaccgaatcgttatcagaggactaaataccattccattgtttgtg
cagctgctttattctcctattgaaaatatccaaagagtagctgcaggggtcctctgtgaa
cttgctcaggacaaggaagctgcagaagctattgaagccgagggagccacagctcctctg
acagaactacttcattctaggaatgagggtgtggcaacatatgcagctgctgttttgttc
cgaatgtctgaggacaagccacaggattataagaaacggctttcagttgagctgaccagt
tctctcttcagaacggagccaatggcttggaatgagaccgctgatcttggacttgatatt
ggtgcccagggagaacctcttggatatcgccaggatgatcccagctatcgttcttttcac
tccggtgggtacggccaggacgccttggggatggaccccatgatggagcatgagatgggc
ggccaccaccccggtgctgactatccagttgacgggctgccagatctggggcatgcccag
gacctcatggatgggctgcccccgggcgacagcaatcagctggcctggtttgatactgac
ctgtaa

DBGET integrated database retrieval system