KEGG   Capra hircus (goat): 106502173
Entry
106502173         CDS       T02910                                 

Gene name
EGF
Definition
(RefSeq) epidermal growth factor
  KO
K04357  epidermal growth factor
Organism
chx  Capra hircus (goat)
Pathway
chx01521  EGFR tyrosine kinase inhibitor resistance
chx04010  MAPK signaling pathway
chx04012  ErbB signaling pathway
chx04014  Ras signaling pathway
chx04015  Rap1 signaling pathway
chx04020  Calcium signaling pathway
chx04066  HIF-1 signaling pathway
chx04068  FoxO signaling pathway
chx04072  Phospholipase D signaling pathway
chx04151  PI3K-Akt signaling pathway
chx04510  Focal adhesion
chx04540  Gap junction
chx04630  JAK-STAT signaling pathway
chx04810  Regulation of actin cytoskeleton
chx05160  Hepatitis C
chx05165  Human papillomavirus infection
chx05200  Pathways in cancer
chx05210  Colorectal cancer
chx05212  Pancreatic cancer
chx05213  Endometrial cancer
chx05214  Glioma
chx05215  Prostate cancer
chx05218  Melanoma
chx05219  Bladder cancer
chx05223  Non-small cell lung cancer
chx05224  Breast cancer
chx05226  Gastric cancer
chx05231  Choline metabolism in cancer
chx05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106502173 (EGF)
   04012 ErbB signaling pathway
    106502173 (EGF)
   04014 Ras signaling pathway
    106502173 (EGF)
   04015 Rap1 signaling pathway
    106502173 (EGF)
   04630 JAK-STAT signaling pathway
    106502173 (EGF)
   04066 HIF-1 signaling pathway
    106502173 (EGF)
   04068 FoxO signaling pathway
    106502173 (EGF)
   04020 Calcium signaling pathway
    106502173 (EGF)
   04072 Phospholipase D signaling pathway
    106502173 (EGF)
   04151 PI3K-Akt signaling pathway
    106502173 (EGF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106502173 (EGF)
   04540 Gap junction
    106502173 (EGF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106502173 (EGF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106502173 (EGF)
   05231 Choline metabolism in cancer
    106502173 (EGF)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    106502173 (EGF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    106502173 (EGF)
   05212 Pancreatic cancer
    106502173 (EGF)
   05226 Gastric cancer
    106502173 (EGF)
   05214 Glioma
    106502173 (EGF)
   05218 Melanoma
    106502173 (EGF)
   05219 Bladder cancer
    106502173 (EGF)
   05215 Prostate cancer
    106502173 (EGF)
   05213 Endometrial cancer
    106502173 (EGF)
   05224 Breast cancer
    106502173 (EGF)
   05223 Non-small cell lung cancer
    106502173 (EGF)
  09172 Infectious disease: viral
   05160 Hepatitis C
    106502173 (EGF)
   05165 Human papillomavirus infection
    106502173 (EGF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    106502173 (EGF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:chx04052]
    106502173 (EGF)
Cytokines and growth factors [BR:chx04052]
 Growth factors
  Growth factors (RTK binding)
   106502173 (EGF)
SSDB
Motif
Pfam: Ldl_recept_b EGF_CA cEGF FXa_inhibition EGF_3 EGF
Other DBs
NCBI-GeneID: 106502173
NCBI-ProteinID: XP_017905399
LinkDB
Position
6
AA seq 1071 aa
MLHFLVIVLLVVFKFSFVSLLALLHWNCPEGSPSGNGNSTCAGLVPFLIFSHGNSIFRID
LEGMNYEQLVADAGVSVITDFCYNEERIYWVDLQRQLLQEGKRXSTVSYINKNVSGMAIN
WINEELIRSNQQEGIITVTDMKGNNSWVLLSALKXPTNTAIDPVARFMFWSSKVAGSLHR
AALGGMEVKLLLETSGKIXAVSLDELDKRLFWIQYHREGGDPCICSCDYDGXSVLFSKYP
LWHNLLAASLFGDRIFYSTWKKKTIWIANKHTGKDMVKITLNSSFVPPSGIKVVHPLVQP
KAEGDAWASAIANNAAKNLKNFSNQVYDFPEEHLLLKKIRNCKVKKGNCSRSMCEQEPKS
QVCMCAXTLSQDGKNCEDVSECASRNHGYTEDCENIPVFILIYFAHTVLKWIERANMDGS
QRERLIEEEVGLAEGLAVDWIGRKLYWTDRGKSLIEGSDLNGKYHEIIIKKGISQPRGIA
VHPMAKRLFWTDMGINPXIESSSLQGSGXLVIASSDLVWPSGIAINYLTDELYWCNAKQS
VIEMSNLDGLKCQRLAQKDVGHPFSVAMFEDPVWFSDWSKDKQIIRTNKRTGKNSVRLQG
SMVKPSSLVVVHPLAKPGADPCLHRNGGCEHICKERFGTAQCLCREGFVKAPDGKMCLAL
DGHRILADNMTNSNLSSEVAPLDVLAGSRELDYNMXESQHLLVAEIMVSDEHVYSEKTED
SLYPAVIIKTDAMGCSTRAECVLEGADVTCQSLKGFAGDGKQCSYVDECEMGLLVCPPTS
SKCVSTEGGYVCQCSEGYQGDGIHCLDIDECRLGVHSCGENATXTNMEGNYTCTFAGDLS
EPGQVCPVSTPPSHLGKNGHNFLKNRFPECSPNFEGYCLSGGICVYFGIANLFSYFPRAQ
SASLLLFTRHSFQGVLKDSEVAIKNPKNPCEELRGDVICSRPADGEAGMPSCPQPWFVVV
KEHXNLGNGSPPKALKEGLAADFGQFSPLDPESLEQSSWRMEPQMHMGTEHGSCIASSND
RGSGDQGMKCSFHLVSEGAWPSAEGTEKSCPLPSAHPLWQQRSPHQMELIQ
NT seq 3216 nt   +upstreamnt  +downstreamnt
atgctgcatttccttgtcattgtgttgctggtagttttcaaatttagttttgttagcctc
ttggccctgctgcactggaactgtcctgaaggctctccctctggaaatgggaattctact
tgtgcaggtcttgtgcccttcttaattttctcccatggaaatagtatctttaggattgac
ttggaaggaatgaattacgaacagttggtggcagatgctggcgtatcagtgatcacggat
ttttgttacaatgaagaaagaatctattgggttgatctacaaagacaactcttgcaagaa
ggcaagaggtaaagtaccgtttcctatataaataaaaatgtttcaggaatggcaataaat
tggatcaatgaagaactgattaggtcaaatcaacaggaaggaatcattacagtaactgat
atgaaaggaaacaattcctgggttctcttaagtgccttaaaatagcctacaaatacagca
attgatccagtagcaaggtttatgttttggtcttcaaaggtggctggcagccttcacaga
gcagctcttggtggtatggaagtgaagcttctgttagagacatcagggaaaatcnnagct
gtatcattggatgagcttgataagcggctcttttggattcagtaccacagagaaggaggt
gatccttgtatttgttcctgtgattatgacggangttctgtcctttttagcaaatacccc
ctgtggcacaacctgcttgcagcctccctctttggtgatcgtatcttctattcaacatgg
aaaaagaagacaatctggatagctaacaagcacacagggaaggatatggttaaaatcacc
ctcaactcgtcatttgtgccacccagtggaattaaagtggttcatccactcgtacagccc
aaggcagagggtgatgcttgggcatctgctattgcgaataatgctgctaaaaatttgaag
aacttttccaatcaggtatatgatttccccgaggagcatcttttattaaaaaagatcaga
aactgcaaagtgaagaaaggtaactgcagccgcagcatgtgtgagcaagagcctaagtcc
caagtgtgcatgtgtgcanncactttaagccaagatggaaagaactgtgaagatgtcagt
gagtgtgcttctcggaatcatggctacacagaggactgtgaaaatatccctgtttttatt
cttatatactttgcccatacagtcctgaagtggatagaaagagctaatatggatggttcc
cagcgagaaaggcttatcgaggaagaagtaggtttagcagaaggtcttgctgttgactgg
attggccgtaaactctactggacagacagagggaaatctctcattgaagggagtgattta
aatggaaagtatcatgaaataatcattaagaagggcatctctcagccacgaggaattgct
gttcatccaatggccaagagattattctggactgacatgggaattaatccatgaattgaa
agttcttctcttcaaggcagtggctgactggttatagctagctcggatctggtctggccc
agtggaatagcaattaattacttaactgacgagttgtattggtgcaatgccaagcagtct
gtgattgaaatgtccaatctggatggcttgaaatgccaaagacttgcccagaaggatgta
ggtcacccattttctgtggctatgtttgaggatcctgtgtggttctctgattggagtaag
gacaaacagataataaggacgaacaagagaactggcaaaaatagtgtacgtctccaaggc
agcatggtgaagccctcatctctggttgtagttcatccattggcaaaaccaggagcagat
ccctgcttacatcgaaatggaggctgtgaacatatttgcaaagagagatttggaactgct
cagtgtttgtgtcgtgaaggttttgtgaaagctccagatggaaaaatgtgtctggctctc
gatggccatcggatattggcagataatatgacaaattccaatctgagtagtgaagttgca
ccattggacgtcttagccggcagcagagagcttgactataacatgnnagagtctcagcac
ctgctagtggccgagatcatggtgtcagatgagcacgtttacagtgaaaagacagaagat
agtttatatcctgctgtgataataaagactgatgccatgggatgcagtacacgggctgag
tgtgttttagagggagcggatgtcacatgtcagagtttgaaaggatttgctggagatgga
aaacaatgttcctatgtagatgaatgtgagatgggtctcttagtttgccctcccacctcc
tccaagtgtgtcagtacagaaggtggctatgtctgccagtgctcagaaggctaccaggga
gatggaatccactgtctggatattgatgagtgccgactgggtgtgcacagctgtggggaa
aatgccacctgaacaaatatggagggaaactacacttgcacgtttgctggcgacttgtct
gagcctggacaggtttgccctgtctctactccgccgtctcaccttgggaagaatggacac
aattttttgaaaaatcgtttccctgaatgttccccgaattttgaagggtactgcctcagt
ggtggtatctgtgtatattttggcattgccaacctgttctcctattttcccagagcacag
agtgcctcacttctgctcttcacccggcactccttccagggggtgctgaaggactcagaa
gtggctattaaaaatccaaagaatccttgtgaagaactgagaggagatgtgatctgtagc
aggcctgcagatggcgaggctgggatgccttcttgcccccaaccttggttcgtggttgta
aaggaacattgaaaccttggaaatgggagtccacccaaggccctcaaggaaggcctggca
gcagattttggccagttttcccccctggatcctgagtccttggaacagtcatcttggaga
atggagccccagatgcatatgggcacagaacacggaagctgtattgcatcatccaatgat
agaggctccggtgaccaggggatgaagtgtagctttcatcttgtctctgaaggggcatgg
cccagtgctgaggggactgagaaatcctgtcctctcccatcagctcaccctttgtggcaa
caaagatctccacaccaaatggagctgattcagtga

DBGET integrated database retrieval system