KEGG   Capra hircus (goat): 106503773
Entry
106503773         CDS       T02910                                 

Gene name
IRF7
Definition
(RefSeq) interferon regulatory factor 7
  KO
K09447  interferon regulatory factor 7
Organism
chx  Capra hircus (goat)
Pathway
chx04620  Toll-like receptor signaling pathway
chx04621  NOD-like receptor signaling pathway
chx04622  RIG-I-like receptor signaling pathway
chx04623  Cytosolic DNA-sensing pathway
chx05160  Hepatitis C
chx05161  Hepatitis B
chx05162  Measles
chx05164  Influenza A
chx05167  Kaposi sarcoma-associated herpesvirus infection
chx05168  Herpes simplex virus 1 infection
chx05169  Epstein-Barr virus infection
chx05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:chx00001]
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    106503773 (IRF7)
   04621 NOD-like receptor signaling pathway
    106503773 (IRF7)
   04622 RIG-I-like receptor signaling pathway
    106503773 (IRF7)
   04623 Cytosolic DNA-sensing pathway
    106503773 (IRF7)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    106503773 (IRF7)
  09172 Infectious disease: viral
   05161 Hepatitis B
    106503773 (IRF7)
   05160 Hepatitis C
    106503773 (IRF7)
   05164 Influenza A
    106503773 (IRF7)
   05162 Measles
    106503773 (IRF7)
   05168 Herpes simplex virus 1 infection
    106503773 (IRF7)
   05167 Kaposi sarcoma-associated herpesvirus infection
    106503773 (IRF7)
   05169 Epstein-Barr virus infection
    106503773 (IRF7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:chx03000]
    106503773 (IRF7)
Transcription factors [BR:chx03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters interferon-regulating factors
    106503773 (IRF7)
SSDB
Motif
Pfam: IRF-3 IRF
Other DBs
NCBI-GeneID: 106503773
NCBI-ProteinID: XP_017898523
UniProt: A0A452E7N2
LinkDB
Position
29
AA seq 480 aa
MAEAPDRGTPRVLFGDWLLGEVSSGRYEGLRWLDAARTRFRVPWKHFARKDLGEADSRIF
KAWAVARGRWPPRSGGGARPIPESALRASWKTNFRCALHSTQRFVMLEDNSGDPTDPHKV
YKISSEPGCREGLGFDQGEDEALEDAPPARGTLPGPCLAADTGESLGHRLNPEPCPPSLA
GDAGDILIQALQQSCLEDHLLDLISPEAPDAGPPPEPWQPPEAEPHVGASASACAPAAGA
PPLAGPGCSQLGLQPEPSLGALDLTILYKGRTVLQEVVGRPSCVLLYGPPSVAGEALGPQ
QVAFPSPAELPDQKQLHYTEKLLQHVAPGLQLELRGPRLWARRLGKCKVYWEVGGPLGSA
SASSPARLLPRDCDTPIFDFGTFFQELVEFRARQCRSSPHYTIYLGFGQDLSVGRPKEKS
LVLVKLEPWLCRAYLEAVQREGVSSLDSGSLSLCLSSSNSLYEDLEHFLEHFMMEVEQAA
NT seq 1443 nt   +upstreamnt  +downstreamnt
atggccgaggctccagaccggggaaccccgcgcgtgctcttcggagactggcttctgggc
gaggtcagcagcggccgctatgaggggctacggtggctggacgcggcccgaacgcgcttc
cgcgtaccctggaagcatttcgcgcggaaggacctgggtgaagcagattcgcgcattttt
aaggcctgggccgtggcccgaggcaggtggccgccccgcagcggtggaggtgcccggccg
atccctgagagtgcgctgcgggcctcctggaaaaccaacttccgctgcgctctgcacagc
acgcagcgcttcgtgatgttggaagacaactcgggggaccctaccgaccctcataaggtg
tacaagatcagctctgagccggggtgccgagaaggcctaggctttgaccagggggaggac
gaggccctagaagatgccccacctgcaaggggcacgctcccggggccatgcctggcagca
gatactggtgagagcctggggcaccggctgaaccctgaaccctgccccccaagcctagct
ggagatgccggggacatcttgatccaggcgctgcagcagagctgcttggaggaccatctt
ctggatctgatctccccagaggctcctgacgcgggcccacccccagagccctggcagccc
ccagaggcggagccgcacgtgggagcctctgccagtgcgtgtgcgccggcggcgggggcg
ccgcccctggctggccctggctgctcacagcttggtctgcagccagagcccagcctaggg
gccctggacttgaccatcctgtataaaggccggacagtgctgcaggaggtggtggggcgt
ccaagctgtgtgctcctgtacggccctcccagcgtagctggagaggctctggggccccag
caggtcgccttccccagccccgccgagctgcccgaccagaagcagctccactacacagag
aagctgcttcagcacgtggcccctggcctgcagctggagctccgggggccgcggctttgg
gcccggcgcctgggcaagtgcaaagtctactgggaggtggggggccccctgggctcggcc
agcgcctccagccccgctcgcctgctgccccgggactgtgacacgcccatctttgacttc
ggcaccttcttccaagaactggtggagttccgggcccggcagtgccgcagctccccgcac
tacaccatctacctgggcttcgggcaggacctgtcagtggggaggcccaaggagaagagc
ctggtcctggtgaagctggagccgtggctgtgccgggcgtacctggaggctgtgcaacgc
gaaggtgtgtcctccctggacagtggcagcctcagcctctgcctctccagctctaacagc
ctctacgaggacctggagcacttcctggagcacttcatgatggaggtggaacaggctgcc
tag

DBGET integrated database retrieval system