KEGG   Capra hircus (goat): 108634241
Entry
108634241         CDS       T02910                                 

Gene name
INS
Definition
(RefSeq) insulin
  KO
K04526  insulin
Organism
chx  Capra hircus (goat)
Pathway
chx04010  MAPK signaling pathway
chx04014  Ras signaling pathway
chx04015  Rap1 signaling pathway
chx04022  cGMP-PKG signaling pathway
chx04066  HIF-1 signaling pathway
chx04068  FoxO signaling pathway
chx04072  Phospholipase D signaling pathway
chx04114  Oocyte meiosis
chx04140  Autophagy - animal
chx04150  mTOR signaling pathway
chx04151  PI3K-Akt signaling pathway
chx04152  AMPK signaling pathway
chx04211  Longevity regulating pathway
chx04213  Longevity regulating pathway - multiple species
chx04810  Regulation of actin cytoskeleton
chx04910  Insulin signaling pathway
chx04911  Insulin secretion
chx04913  Ovarian steroidogenesis
chx04914  Progesterone-mediated oocyte maturation
chx04917  Prolactin signaling pathway
chx04923  Regulation of lipolysis in adipocytes
chx04930  Type II diabetes mellitus
chx04931  Insulin resistance
chx04932  Non-alcoholic fatty liver disease
chx04940  Type I diabetes mellitus
chx04950  Maturity onset diabetes of the young
chx04960  Aldosterone-regulated sodium reabsorption
chx05010  Alzheimer disease
chx05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108634241 (INS)
   04014 Ras signaling pathway
    108634241 (INS)
   04015 Rap1 signaling pathway
    108634241 (INS)
   04066 HIF-1 signaling pathway
    108634241 (INS)
   04068 FoxO signaling pathway
    108634241 (INS)
   04072 Phospholipase D signaling pathway
    108634241 (INS)
   04022 cGMP-PKG signaling pathway
    108634241 (INS)
   04151 PI3K-Akt signaling pathway
    108634241 (INS)
   04152 AMPK signaling pathway
    108634241 (INS)
   04150 mTOR signaling pathway
    108634241 (INS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    108634241 (INS)
  09143 Cell growth and death
   04114 Oocyte meiosis
    108634241 (INS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    108634241 (INS)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    108634241 (INS)
   04910 Insulin signaling pathway
    108634241 (INS)
   04923 Regulation of lipolysis in adipocytes
    108634241 (INS)
   04913 Ovarian steroidogenesis
    108634241 (INS)
   04914 Progesterone-mediated oocyte maturation
    108634241 (INS)
   04917 Prolactin signaling pathway
    108634241 (INS)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    108634241 (INS)
  09149 Aging
   04211 Longevity regulating pathway
    108634241 (INS)
   04213 Longevity regulating pathway - multiple species
    108634241 (INS)
 09160 Human Diseases
  09162 Cancer: specific types
   05215 Prostate cancer
    108634241 (INS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108634241 (INS)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    108634241 (INS)
   04940 Type I diabetes mellitus
    108634241 (INS)
   04950 Maturity onset diabetes of the young
    108634241 (INS)
   04932 Non-alcoholic fatty liver disease
    108634241 (INS)
   04931 Insulin resistance
    108634241 (INS)
SSDB
Motif
Pfam: Insulin Ins_beta
Other DBs
NCBI-GeneID: 108634241
NCBI-ProteinID: XP_017898972
UniProt: A0A452E6C9
LinkDB
Position
29
AA seq 105 aa
MALWTRLVPLLALLALWAPAPARAFVNQHLCGSHLVEALYLVCGERGFFYTPKARREVEG
PQVGVLELAGGPGAGSLEGPPQKRGIVEQCCAGVCSLYQLENYCN
NT seq 318 nt   +upstreamnt  +downstreamnt
atggccctgtggacacgcctggtgcccctgctggccctgctggcgctctgggcccccgcc
ccggcccgcgccttcgtcaaccagcacctgtgcggctcccacctggtggaggcgctgtac
ctggtttgcggagagcgcggcttcttctacacgcccaaggcccgccgggaggtggagggc
ccccaggtgggggtgctggagctggccggaggccctggcgcgggcagcctggaggggccc
ccccagaagcgtggcatcgtggagcagtgctgtgccggcgtctgctctctctaccagctg
gagaattactgcaactag

DBGET integrated database retrieval system