KEGG   Capra hircus (goat): 108638619
Entry
108638619         CDS       T02910                                 

Gene name
RAF1
Definition
(RefSeq) Raf-1 proto-oncogene, serine/threonine kinase
  KO
K04366  RAF proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
chx  Capra hircus (goat)
Pathway
chx01521  EGFR tyrosine kinase inhibitor resistance
chx01522  Endocrine resistance
chx04010  MAPK signaling pathway
chx04012  ErbB signaling pathway
chx04014  Ras signaling pathway
chx04015  Rap1 signaling pathway
chx04022  cGMP-PKG signaling pathway
chx04024  cAMP signaling pathway
chx04062  Chemokine signaling pathway
chx04068  FoxO signaling pathway
chx04071  Sphingolipid signaling pathway
chx04072  Phospholipase D signaling pathway
chx04140  Autophagy - animal
chx04150  mTOR signaling pathway
chx04151  PI3K-Akt signaling pathway
chx04210  Apoptosis
chx04218  Cellular senescence
chx04270  Vascular smooth muscle contraction
chx04360  Axon guidance
chx04370  VEGF signaling pathway
chx04371  Apelin signaling pathway
chx04510  Focal adhesion
chx04540  Gap junction
chx04550  Signaling pathways regulating pluripotency of stem cells
chx04613  Neutrophil extracellular trap formation
chx04625  C-type lectin receptor signaling pathway
chx04630  JAK-STAT signaling pathway
chx04650  Natural killer cell mediated cytotoxicity
chx04660  T cell receptor signaling pathway
chx04662  B cell receptor signaling pathway
chx04664  Fc epsilon RI signaling pathway
chx04666  Fc gamma R-mediated phagocytosis
chx04720  Long-term potentiation
chx04722  Neurotrophin signaling pathway
chx04726  Serotonergic synapse
chx04730  Long-term depression
chx04810  Regulation of actin cytoskeleton
chx04910  Insulin signaling pathway
chx04912  GnRH signaling pathway
chx04914  Progesterone-mediated oocyte maturation
chx04915  Estrogen signaling pathway
chx04916  Melanogenesis
chx04917  Prolactin signaling pathway
chx04919  Thyroid hormone signaling pathway
chx04921  Oxytocin signaling pathway
chx04926  Relaxin signaling pathway
chx04928  Parathyroid hormone synthesis, secretion and action
chx04929  GnRH secretion
chx04935  Growth hormone synthesis, secretion and action
chx05010  Alzheimer disease
chx05022  Pathways of neurodegeneration - multiple diseases
chx05034  Alcoholism
chx05132  Salmonella infection
chx05152  Tuberculosis
chx05160  Hepatitis C
chx05161  Hepatitis B
chx05163  Human cytomegalovirus infection
chx05164  Influenza A
chx05165  Human papillomavirus infection
chx05167  Kaposi sarcoma-associated herpesvirus infection
chx05170  Human immunodeficiency virus 1 infection
chx05200  Pathways in cancer
chx05205  Proteoglycans in cancer
chx05206  MicroRNAs in cancer
chx05210  Colorectal cancer
chx05211  Renal cell carcinoma
chx05212  Pancreatic cancer
chx05213  Endometrial cancer
chx05214  Glioma
chx05215  Prostate cancer
chx05218  Melanoma
chx05219  Bladder cancer
chx05220  Chronic myeloid leukemia
chx05221  Acute myeloid leukemia
chx05223  Non-small cell lung cancer
chx05224  Breast cancer
chx05225  Hepatocellular carcinoma
chx05226  Gastric cancer
chx05230  Central carbon metabolism in cancer
chx05231  Choline metabolism in cancer
chx05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:chx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108638619 (RAF1)
   04012 ErbB signaling pathway
    108638619 (RAF1)
   04014 Ras signaling pathway
    108638619 (RAF1)
   04015 Rap1 signaling pathway
    108638619 (RAF1)
   04370 VEGF signaling pathway
    108638619 (RAF1)
   04371 Apelin signaling pathway
    108638619 (RAF1)
   04630 JAK-STAT signaling pathway
    108638619 (RAF1)
   04068 FoxO signaling pathway
    108638619 (RAF1)
   04072 Phospholipase D signaling pathway
    108638619 (RAF1)
   04071 Sphingolipid signaling pathway
    108638619 (RAF1)
   04024 cAMP signaling pathway
    108638619 (RAF1)
   04022 cGMP-PKG signaling pathway
    108638619 (RAF1)
   04151 PI3K-Akt signaling pathway
    108638619 (RAF1)
   04150 mTOR signaling pathway
    108638619 (RAF1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    108638619 (RAF1)
  09143 Cell growth and death
   04210 Apoptosis
    108638619 (RAF1)
   04218 Cellular senescence
    108638619 (RAF1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108638619 (RAF1)
   04540 Gap junction
    108638619 (RAF1)
   04550 Signaling pathways regulating pluripotency of stem cells
    108638619 (RAF1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    108638619 (RAF1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    108638619 (RAF1)
   04625 C-type lectin receptor signaling pathway
    108638619 (RAF1)
   04650 Natural killer cell mediated cytotoxicity
    108638619 (RAF1)
   04660 T cell receptor signaling pathway
    108638619 (RAF1)
   04662 B cell receptor signaling pathway
    108638619 (RAF1)
   04664 Fc epsilon RI signaling pathway
    108638619 (RAF1)
   04666 Fc gamma R-mediated phagocytosis
    108638619 (RAF1)
   04062 Chemokine signaling pathway
    108638619 (RAF1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    108638619 (RAF1)
   04929 GnRH secretion
    108638619 (RAF1)
   04912 GnRH signaling pathway
    108638619 (RAF1)
   04915 Estrogen signaling pathway
    108638619 (RAF1)
   04914 Progesterone-mediated oocyte maturation
    108638619 (RAF1)
   04917 Prolactin signaling pathway
    108638619 (RAF1)
   04921 Oxytocin signaling pathway
    108638619 (RAF1)
   04926 Relaxin signaling pathway
    108638619 (RAF1)
   04935 Growth hormone synthesis, secretion and action
    108638619 (RAF1)
   04919 Thyroid hormone signaling pathway
    108638619 (RAF1)
   04928 Parathyroid hormone synthesis, secretion and action
    108638619 (RAF1)
   04916 Melanogenesis
    108638619 (RAF1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    108638619 (RAF1)
  09156 Nervous system
   04726 Serotonergic synapse
    108638619 (RAF1)
   04720 Long-term potentiation
    108638619 (RAF1)
   04730 Long-term depression
    108638619 (RAF1)
   04722 Neurotrophin signaling pathway
    108638619 (RAF1)
  09158 Development and regeneration
   04360 Axon guidance
    108638619 (RAF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108638619 (RAF1)
   05206 MicroRNAs in cancer
    108638619 (RAF1)
   05205 Proteoglycans in cancer
    108638619 (RAF1)
   05230 Central carbon metabolism in cancer
    108638619 (RAF1)
   05231 Choline metabolism in cancer
    108638619 (RAF1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    108638619 (RAF1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    108638619 (RAF1)
   05212 Pancreatic cancer
    108638619 (RAF1)
   05225 Hepatocellular carcinoma
    108638619 (RAF1)
   05226 Gastric cancer
    108638619 (RAF1)
   05214 Glioma
    108638619 (RAF1)
   05221 Acute myeloid leukemia
    108638619 (RAF1)
   05220 Chronic myeloid leukemia
    108638619 (RAF1)
   05218 Melanoma
    108638619 (RAF1)
   05211 Renal cell carcinoma
    108638619 (RAF1)
   05219 Bladder cancer
    108638619 (RAF1)
   05215 Prostate cancer
    108638619 (RAF1)
   05213 Endometrial cancer
    108638619 (RAF1)
   05224 Breast cancer
    108638619 (RAF1)
   05223 Non-small cell lung cancer
    108638619 (RAF1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108638619 (RAF1)
   05022 Pathways of neurodegeneration - multiple diseases
    108638619 (RAF1)
  09165 Substance dependence
   05034 Alcoholism
    108638619 (RAF1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108638619 (RAF1)
   05152 Tuberculosis
    108638619 (RAF1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108638619 (RAF1)
   05161 Hepatitis B
    108638619 (RAF1)
   05160 Hepatitis C
    108638619 (RAF1)
   05164 Influenza A
    108638619 (RAF1)
   05163 Human cytomegalovirus infection
    108638619 (RAF1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108638619 (RAF1)
   05165 Human papillomavirus infection
    108638619 (RAF1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    108638619 (RAF1)
   01522 Endocrine resistance
    108638619 (RAF1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:chx01001]
    108638619 (RAF1)
Enzymes [BR:chx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     108638619 (RAF1)
Protein kinases [BR:chx01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   108638619 (RAF1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like Pkinase_fungal C1_2
Other DBs
NCBI-GeneID: 108638619
NCBI-ProteinID: XP_017922447
UniProt: A0A452DTI5
LinkDB
Position
22
AA seq 648 aa
MEHIQGAWKTISNGFGFKDTVFDGASCISPTIVQQFGYQRRASDDGKLTDPSKTSNTIRV
FLPNKQRTVVNVRNGMSLHDCLMKALKVRGLQPECCAVFRLLHEHKGKKARLDWNTDAAS
LIGEELQVDFLDHVPLTTHNFARKTFLKLAFCDICQKFLLNGFRCQTCGYKFHEHCSTKV
PTMCVDWSNIRQLLLFPNSTVGDGGVPALPSLTMRRMRESVSRIPPGSQHRYSTPHAFTF
STSSPSSEGSLSQRQRSTSTPNVHMVSAALPVDSRMIEDAIRSHSESGSPSALSSSPNNL
SPTGWSQPKTPAPAQRERAPGSSTQEKNKIRPRGQRDSSYYWEIEASEVMLSTRIGSGSF
GTVYKGKWHGDVAVKILKVVDPTPEQFQAFRNEVAVLRKTRHVNILLFMGYMTKDNLAIV
TQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGMDYLHAKNIIHRDMKSNNIFLHEGL
TVKIGDFGLATVKSRWSGSQQVEQPTGSILWMAPEVIRMQDNNPFSFQSDVYSYGIVLYE
LMTGELPYSHINNRDQIIFMVGRGYASPDLSKLYKNCPKAMKRLVADCVKKVKEERPLFP
QILSSIELLQHSLPKINRSASEPSLHRAAHTEDINACTLTTSPRLPVF
NT seq 1947 nt   +upstreamnt  +downstreamnt
atggagcacatacagggcgcctggaagacgatcagcaacggtttcgggttcaaagacacg
gtgtttgacggcgccagctgcatctcccctacaatagttcagcagtttggctatcagcgt
cgggcgtcagatgatggcaagcttacggacccttctaagacaagcaacactatccgtgtg
tttttgccaaacaagcaaagaacagtggtcaacgtgcggaatggaatgagcttgcatgac
tgccttatgaaagctctcaaggtgaggggcctgcaaccagagtgctgtgcagtgttcaga
cttctccacgaacacaagggtaaaaaagcacggttagattggaatactgatgctgcctcg
ttgatcggagaggaacttcaagtggatttcctggatcatgttcccctcacaacacacaac
tttgctcggaaaaccttcctgaagcttgccttctgtgacatctgtcagaagttcttgcta
aatggatttagatgtcagacttgtggctacaagtttcacgagcattgtagcaccaaagta
cccactatgtgtgtggactggagtaatatcagacagctcttattgttcccaaattccact
gttggtgatggcggggtcccagcgctgccttctttgacgatgcgtcggatgcgagagtct
gtttcccggatacctcctggttcccagcacagatactccacaccccacgctttcacattc
agcacctccagcccctcctctgaaggctccctctcccagaggcagaggtcgacgtccacg
ccaaacgtgcacatggtcagcgccgctctgcccgtggacagcaggatgatcgaggatgca
attcgaagtcacagtgaatcaggctccccttcagccttgtccagcagccccaacaatctg
agcccgacaggctggtcacagcccaaaacccctgcgcctgcccagagagagcgggcgcca
ggctccagcacccaggagaagaacaaaattaggcctcgtggacagagagattcgagctat
tactgggagatagaagccagtgaagtgatgctgtccactcggattggatcaggctccttc
gggactgtttataagggcaagtggcatggagatgttgcagtaaagattctgaaggttgtt
gaccccacgccagagcagttccaggccttcaggaacgaggtggctgtcctccgcaaaacc
cggcacgtgaacatcctgctcttcatggggtacatgacgaaggacaacctggcgatagtg
acgcagtggtgcgagggcagcagcctctacaagcacctgcacgtccaggagaccaagttc
cagatgttccagctgattgacattgcccggcagacggctcagggaatggactatttgcat
gcaaagaacatcatccacagagacatgaaatccaataatatatttctccacgaaggccta
acggtgaaaatcggcgattttggattggccacggtgaagtcgcgctggagtggttctcag
caggtcgagcagcccaccggctccatcctgtggatggccccagaggtgatccggatgcag
gataataacccgttcagcttccagtctgacgtctattcctatggcatcgtgctgtatgag
ctcatgacgggggagctcccttactcccacatcaacaaccgcgaccagatcatcttcatg
gtgggccgcgggtacgcctccccagacctcagcaagctgtacaagaactgccccaaagcc
atgaagaggctggtagccgactgtgtgaagaaagtgaaggaagagaggcctctttttccc
cagatcctgtcttccatcgagctgctccagcactctctgcccaagatcaaccggagcgcc
tcggagccctccctgcaccgagcggcccacaccgaggacatcaacgcctgcacgctgacc
acgtcccctcggctgcccgtcttctag

DBGET integrated database retrieval system