KEGG   Carboxydothermus hydrogenoformans: CHY_0282Help
Entry
CHY_0282          CDS       T00287                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
chy  Carboxydothermus hydrogenoformans
Pathway
chy00010  Glycolysis / Gluconeogenesis
chy00051  Fructose and mannose metabolism
chy01100  Metabolic pathways
chy01110  Biosynthesis of secondary metabolites
chy01120  Microbial metabolism in diverse environments
chy01130  Biosynthesis of antibiotics
chy01200  Carbon metabolism
chy01230  Biosynthesis of amino acids
Module
chy_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
chy_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:chy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CHY_0282 (tpiA)
   00051 Fructose and mannose metabolism
    CHY_0282 (tpiA)
   00562 Inositol phosphate metabolism
    CHY_0282 (tpiA)
Enzymes [BR:chy01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CHY_0282 (tpiA)
Exosome [BR:chy04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CHY_0282 (tpiA)
  Exosomal proteins of bladder cancer cells
   CHY_0282 (tpiA)
  Exosomal proteins of melanoma cells
   CHY_0282 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABB15245
UniProt: Q3AFD0
LinkDB All DBs
Position
248431..249186
Genome map
AA seq 251 aa AA seqDB search
MRKPFIAGNWKMYKTPVEAAGFVRELIDSLKDVSGVDVAVCPPFPALWPVKEALEGSNIA
LGAQNMHFEKEGAFTGEVSPAMLQDIGVKYVILGHSERRAYFGETDELINQKIKAAFTWG
LNPIFCVGETLEERERGITKAVVEIQVLKGLAGVTAEQAENLTIAYEPVWAIGTGKTATP
DDAQEVCQFIRELLVKLFGREIADKVRIQYGGSVKPENIKELIAKPDIDGALVGGASLKV
ESFTAIVKGSI
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaccttttattgctggcaactggaaaatgtataaaacccctgtcgaggcggcc
ggatttgtccgtgagctcatcgatagcttaaaagatgttagcggtgtggacgtagcggtc
tgtccgccttttcctgccctgtggccggttaaggaagcattagaggggagcaatattgct
ctgggagcccagaacatgcattttgaaaaggaaggggcttttaccggtgaagtatctccg
gccatgcttcaagatataggggttaagtacgtaatcttgggacactccgagcggagagct
tactttggggaaacggacgaacttattaaccagaaaataaaggcagcttttacctgggga
ctaaatcctatcttttgcgttggcgaaactttggaagagcgggaacggggaattaccaag
gcagtagtggaaattcaggtgttaaagggcctggctggagttacggcagagcaggccgaa
aacctgaccattgcttacgagccggtatgggcaattggtaccggaaaaaccgcaactccc
gatgatgctcaggaagtgtgccagtttatccgggaacttttggtaaagcttttcgggcgg
gagatagcggataaagttcgcattcagtacggtggtagtgttaagccggaaaatattaaa
gagcttattgccaaaccggatatcgacggtgccttagtaggcggtgccagcttaaaagta
gaaagctttaccgcaatagttaaaggcagtatttaa

DBGET integrated database retrieval system