KEGG   Carboxydothermus hydrogenoformans: CHY_0735Help
Entry
CHY_0735          CDS       T00287                                 

Gene name
cooF2
Definition
(GenBank) iron-sulfur cluster-binding protein CooF
  KO
K00196  anaerobic carbon-monoxide dehydrogenase iron sulfur subunit
Organism
chy  Carboxydothermus hydrogenoformans
Pathway
chy00633  Nitrotoluene degradation
chy00680  Methane metabolism
chy00720  Carbon fixation pathways in prokaryotes
chy01100  Metabolic pathways
chy01120  Microbial metabolism in diverse environments
chy01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:chy00001]
 09100 Metabolism
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    CHY_0735 (cooF2)
   00680 Methane metabolism
    CHY_0735 (cooF2)
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    CHY_0735 (cooF2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_11 Fer4_6 Fer4_7 Fer4_2 Fer4_9 Fer4 Fer4_10 Fer4_16 Fer4_21 Fer4_4 Fer4_3 Fer4_17 Fer4_13 Fer4_15
Motif
Other DBs
NCBI-ProteinID: ABB15090
UniProt: Q3AE45
LinkDB All DBs
Position
649247..649732
Genome map
AA seq 161 aa AA seqDB search
MREILVDLEKCLGCKTCELVCATSHSKTKELYTAISENPRPQRRIFVEANGSTNFPLMCR
HCEDAPCVTACMSGALTKDELTGEVLLNSQRCIGCFMCVMVCPFGVIIENQHKAAKCDRC
AEIGYPQCVLACPTKALSFAEVPVYAKKERKKYLTNFLMKE
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
ttgcgtgagattttagttgatttagaaaaatgccttggttgtaaaacctgtgaactggtt
tgtgctacctcccattctaagactaaagagctatatacagcaatctcagaaaatccccga
ccgcaaagacggatttttgttgaggccaatggttccaccaatttccctttgatgtgccgg
cattgtgaagacgctccctgtgttaccgcttgcatgagcggagctttaaccaaagatgaa
ctaaccggtgaagtgctgttaaactcccaaaggtgtattggctgttttatgtgcgtgatg
gtttgtcctttcggagtaattatcgaaaaccagcataaagccgcgaaatgtgaccgctgt
gctgaaattggctatccccagtgcgttttagcctgtcccaccaaagccctgtcctttgca
gaagttcccgtttatgccaaaaaggaacgaaagaaatacttaacaaattttttgatgaag
gagtga

DBGET integrated database retrieval system