KEGG   Carboxydothermus hydrogenoformans: CHY_0736Help
Entry
CHY_0736          CDS       T00287                                 

Gene name
cooSIV
Definition
(GenBank) carbon-monoxide dehydrogenase, catalytic subunit
  KO
K00198  anaerobic carbon-monoxide dehydrogenase catalytic subunit [EC:1.2.7.4]
Organism
chy  Carboxydothermus hydrogenoformans
Pathway
chy00633  Nitrotoluene degradation
chy00680  Methane metabolism
chy00720  Carbon fixation pathways in prokaryotes
chy01100  Metabolic pathways
chy01120  Microbial metabolism in diverse environments
chy01200  Carbon metabolism
Module
chy_M00377  Reductive acetyl-CoA pathway (Wood-Ljungdahl pathway)
chy_M00618  Acetogen
Brite
KEGG Orthology (KO) [BR:chy00001]
 09100 Metabolism
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    CHY_0736 (cooSIV)
   00680 Methane metabolism
    CHY_0736 (cooSIV)
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    CHY_0736 (cooSIV)
Enzymes [BR:chy01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.4  anaerobic carbon-monoxide dehydrogenase
     CHY_0736 (cooSIV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Prismane
Motif
Other DBs
NCBI-ProteinID: ABB15066
UniProt: Q3AE44
LinkDB All DBs
Structure
PDB: 

Position
649737..651638
Genome map
AA seq 633 aa AA seqDB search
MDKSKLSVDPVIPNLYRKAREEGISTVFDRYEAQQPQCGFGLTGLCCRHCVQGPCRIDPF
GEGPQAGICGATAEVITARNLLRQVTAGAAAHVDHAYDVLEVLEQIAQGTESYSIKDQEK
LKQVAFTLGIDTANKTEQEIVEEMCQIIYRDFANSGATPMTYLKANSPRERLETWEKLGV
LPRNPDREIREALHQTTMGMDADPVNLILKTIRLGLVDGFAGLKLATDLQDIIFGTPQPV
VTEANLGVLKEDYVNIIVHGHVPLLSEKIVEWSRKLEDEAKKAGAKGINLAGICCTGNEV
LMRQGVPLATNFLAQELAIITGAVDLMVVDVQCIMPSLAEIAACYHTRLVTTMPIVKIPG
AEHVPFTTETADEASQQIVRMAIESYQKRNPAKVYIPREKAKVVAGFSVEAIVKALAKLN
PDDPLKPLIDNIVSGNILGVVATVGCNNVKVKHDWFHIELVKELIKNNVLVVTTGCSAHA
LAKAGLMDPAAAEWAGEGLRAVLTAIGTANDLGGPLPPVLHMGSCVDNSRIGDLVIAVAN
YLKVSPKDLPIAASAPEYQHEKALSIGTWAVAMGIMTHLGVVPPVVGSSKVTRILTQDAE
ALIGGKFYVETDPYKAAAGIIEHIKAKRALLNL
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atggataaaagcaaattatcggtagacccggtaattcccaatctttatcggaaagcccgg
gaagaagggatttccaccgtttttgaccggtatgaagcgcagcagcctcagtgcggtttt
ggcttaacaggcctttgctgtcgtcactgcgtccagggaccgtgccggatcgaccccttt
ggggaaggaccgcaagcgggaatttgcggggcaacggccgaagtaataacggcaagaaat
ctactgcgtcaggtaactgccggtgctgccgctcatgtggaccatgcctatgatgttctg
gaagttttggaacaaattgcccaaggtacggaaagctacagtattaaggatcaggaaaaa
ttaaagcaggtagcttttaccttaggtatagatacagctaataaaacagagcaggaaatt
gttgaagaaatgtgccaaattatctaccgggattttgccaattccggcgcaactcccatg
acctacctgaaagccaattctccgcgggagcgcctcgaaacctgggaaaagttaggagta
ctgccgcgaaacccggacagggaaattagagaagctctgcaccagactacaatggggatg
gatgcggacccggtaaatttaatcttaaagactatccggcttggtctggtggatggtttt
gcgggactcaagctggccacggacttacaggacataatatttggaactccccagccggtg
gtaacagaagccaacctgggtgtacttaaagaagactacgtcaatatcattgtccatggc
cacgtacctttgctttcggaaaaaattgttgagtggagcagaaaattggaagatgaggcg
aaaaaggcaggggcaaaaggaatcaatcttgccgggatatgttgtaccggtaatgaagtg
ttaatgcggcaaggggttcctctggcgactaacttcctggcccaggaattggcgattatt
accggcgctgtggatttaatggtagtggatgttcagtgcattatgccgtctttagcggaa
attgctgcttgctaccatacccgcctggtcactaccatgcctattgtcaaaattcccgga
gcggaacacgtaccttttaccaccgaaactgccgatgaagcctcccagcagattgtccgg
atggctattgaaagttaccaaaaaagaaatccagccaaggtctatattcccagggaaaaa
gccaaagtagtagcaggatttagcgtggaagcaatagtaaaagctttagcgaaactaaat
cctgatgacccgttaaagcccttaattgacaatattgtttctggcaatattctgggggta
gtggctaccgtaggttgtaataacgtcaaagtaaaacacgattggtttcatatagaactg
gtaaaagaattaattaaaaacaacgttttagtagttactaccggctgttccgctcatgcc
ttagccaaagcaggattgatggatcccgcagcagccgaatgggctggcgaagggttaaga
gctgtcttaacggcaataggtacggccaatgatttgggaggaccgctgcctccggttttg
cacatgggaagctgtgtggataattcccgaatcggggatttagtcatagccgtagccaat
taccttaaagttagtcccaaagacctgccaattgctgcttctgccccggaataccagcat
gaaaaagctttgagcattggaacctgggcggtggcgatgggaataatgacccacctggga
gttgttccaccggttgttggaagttccaaagttacccggattttaacccaggacgccgaa
gctttaattggcggtaagttttacgtggaaacggatccttataaagcagcagccggtatt
attgaacatattaaagctaaacgggctttgttaaacctttag

DBGET integrated database retrieval system