KEGG   Carboxydothermus hydrogenoformans: CHY_1343Help
Entry
CHY_1343          CDS       T00287                                 

Definition
(GenBank) putative serine/threonine protein kinase
Organism
chy  Carboxydothermus hydrogenoformans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr NERD Haspin_kinase Kdo Pkinase_fungal DAPG_hydrolase
Motif
Other DBs
NCBI-ProteinID: ABB15387
UniProt: Q3ACF7
LinkDB All DBs
Position
1201771..1204065
Genome map
AA seq 764 aa AA seqDB search
MGITIKEVSRISGVFGQQGEEKVAEVLKEHLPDGYKIINSYRLNYQGDSWDIDHIVIGPN
GIFVIETKNMRGRVFGGAMGNWWQEKWAGGQKEKIKIGNPAAQVNHYAKLVKEFLRLYFP
EEETRILVYPVVVFAHEEADFSKLRFTRPGRIGKTKILSLYELPAFILSREEVSYDSDFI
DKAINFLIPEDEREKTGMFKTGLYYQNLQEQFSRRYRLEDLIGEGNFSKVYWAYDNKLDR
EVAVKEINLTDLPGDIKDKIYNEAQLMAKINHENIVKLYDTFYFDDKIYLIIELVQGKTL
VEYLEEKGGMLSVKKAVNIMIQIAKALSYIHQHNIIHRDLKPENILISTDDIVKITDFGI
AQLNEEEKEEGFILGTPVVMAPEQILKTGIDQRTDIFALGCIFYYLLTGHYPFSGTNFSE
LSYNILHFDPEPIRTYNSHCSLEIEKIILKCLEKNPENRYQKVSELLQDLIKYQEQKNLG
LFFNKKTFLKIALVVLGIAFLYLFTLGTSMQNQGSAPISLNEILNKEQITLTNDNFNQVF
ANNYLAGAKVKITGRILDIIGAQNGRTLCYFLLEPASLKDNKLTIALNLDPFSIFNGTKY
YQLEGFLAYSPLVENGAAKPVVIVERYKPLEPWHLFDPPIKTVEVKQTLKRKDKEIIFEK
IEFGKNETRLFITLRNLSNHPVNFNLLEPRASQKDRFYVEALYQNRDYPKLKDQLGPKEI
VRGIIVLEKMDYQIKEAVFFLGLTMAGEEPYIFHVRWGDENTGN
NT seq 2295 nt NT seq  +upstreamnt  +downstreamnt
atgggaataaccatcaaggaagtttccaggatatcgggagtatttggccaacaaggagaa
gaaaaagtagccgaagtactaaaagagcacctgcctgatggttataaaattataaattct
taccgtttaaattatcaaggtgacagctgggatattgaccatattgtcattggccccaat
ggtatttttgttattgaaaccaaaaacatgcggggccgggtttttggtggcgccatgggc
aactggtggcaggaaaagtgggcaggagggcaaaaagaaaaaattaagattggcaatcct
gccgctcaggtaaaccattatgccaaacttgtcaaagagtttttacggctttatttccct
gaggaagaaaccagaatcttggtttaccctgtagttgtctttgctcacgaagaagctgac
ttttctaagcttcgttttacccgtcctggcagaattggtaaaaccaaaatccttagttta
tatgaacttccggcatttattttaagcagggaagaggtttcttacgattcagattttatt
gataaagcgataaatttcttaattcccgaagatgaacgggaaaaaaccggtatgtttaaa
accggtctttattaccaaaaccttcaagaacagttttcccggcgctatcggttagaagat
ctgatcggcgagggaaatttcagcaaggtttactgggcatacgataataagctggatcgg
gaagtagcggttaaagaaattaatttaacagatctaccgggggatatcaaagataaaatc
tataatgaagcccagttaatggcaaaaattaatcatgaaaatatcgtgaaactttatgat
accttttattttgatgacaaaatatatctgataattgaattggtgcaggggaaaacctta
gttgaatatcttgaagaaaagggcggaatgctttccgttaagaaagctgtaaatataatg
attcaaattgccaaagccctttcttatattcaccagcacaacattattcaccgggattta
aaaccggaaaatatcttaatttctaccgacgatattgtaaaaataacagattttggtata
gctcaactaaacgaagaagaaaaagaagaaggctttatcttgggtactccggtagttatg
gctccggaacaaatattaaaaacgggtattgaccagcgaacagatatttttgctttggga
tgtattttttactatttattaaccggtcattatccgttttctggaacaaatttttccgaa
ttaagttataacatactccattttgatcctgaacctattcggacttacaatagtcattgt
agtttagaaattgaaaaaattattttaaaatgcttagaaaaaaatcccgaaaaccgttat
caaaaggttagtgaactacttcaggacttgattaaatatcaagagcaaaaaaaccttggt
ttattttttaataagaaaacttttctaaaaatagctttggtagttttaggcattgctttt
ttgtatctttttaccttaggtacaagcatgcaaaatcaaggtagtgctcctatatcctta
aacgaaattttaaataaagagcaaattacccttaccaatgataatttcaatcaagttttt
gccaataattacctggcaggagctaaagttaaaataacaggaaggattcttgatataatt
ggcgcccaaaacggtcgcaccttgtgttattttttattagaaccggcttcgttaaaggat
aataaactaacaatagccttaaatcttgatcccttttccatttttaatggtactaaatat
taccaattagaaggctttttagcttattctcctttagtcgaaaacggtgctgccaaaccg
gtggttattgtcgaaagatataaacctcttgagccctggcatctttttgaccctccaatt
aaaacggtagaagttaagcaaaccttaaaacgaaaagataaagaaattatctttgaaaaa
attgaatttggtaaaaacgaaaccagactctttattacattaagaaatctttccaaccat
ccggtgaattttaatttattagaacccagagccagtcaaaaagatcgcttttacgtagaa
gcgttgtatcaaaaccgggattatccaaaactaaaagaccaattaggacctaaagaaatt
gtcaggggaattatcgtgctggaaaaaatggattaccagattaaagaggcagtatttttt
ctcggcctgactatggctggagaagaaccatatatttttcatgtgaggtggggagatgaa
aatactgggaattag

DBGET integrated database retrieval system