KEGG   Carboxydothermus hydrogenoformans: CHY_1346Help
Entry
CHY_1346          CDS       T00287                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
chy  Carboxydothermus hydrogenoformans
Pathway
chy00473  D-Alanine metabolism
chy00550  Peptidoglycan biosynthesis
chy01100  Metabolic pathways
chy01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:chy00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CHY_1346 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CHY_1346 (ddl)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    CHY_1346 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:chy01011]
    CHY_1346 (ddl)
Enzymes [BR:chy01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CHY_1346 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:chy01011]
 Precursor biosynthesis
  Amino acid ligase
   CHY_1346 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 GARS_A CPSase_L_D2 ATP-grasp RimK ATP-grasp_4 ATPgrasp_ST TTL ATPgrasp_Ter
Motif
Other DBs
NCBI-ProteinID: ABB14185
UniProt: Q3ACF5
LinkDB All DBs
Position
1205125..1206063
Genome map
AA seq 312 aa AA seqDB search
MKIGVICGGLSSEREVSLRTGDAIFRALLKKGYNVVKIDMDRNIAETLKKENIDFAFIAL
HGKYGEDGAIQGLLEIMDIPYTGSGILASSLAIDKIMTKKILKAEGIPTPNYIAFSFDEN
PNFEAISSEILQTLKLPVVIKAPREGSTIGIEFVFSKQELPKAIKKVLEIDKQLLVEEFI
EGVEVTASVLGNSNPVVLPLIEIVSKTRFYDYEAKYTPGLSEHIIPPRIAPELSQKAIEY
ARKTYKALGCRGFARVDFMIDVRKNEAYVLEVNTIPGMTATSLFPDAAKAQGISFEDLVE
KILMLGLEGRQK
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattggcgttatttgcggcgggctttcttccgaaagagaagtttctctacgtacc
ggcgacgcgatttttagagctttattaaaaaagggatacaacgttgtaaaaatcgatatg
gacagaaatattgccgaaacattaaaaaaggaaaatatcgattttgcctttattgccctt
cacgggaagtacggggaagacggagccatccaggggctacttgaaattatggatatcccc
tatactggctccggaatacttgccagtagtttagcaattgataaaataatgacaaagaaa
attttaaaagccgagggaattccgacaccaaactatattgcttttagctttgatgaaaac
cccaattttgaagctatcagttctgaaatactgcaaacattgaaacttcccgtggtaata
aaagctccccgcgaaggttcaactattggcattgagtttgtttttagcaaacaagagcta
ccgaaagctattaaaaaagttttagaaatagataaacagcttttggttgaagaatttatt
gaaggggtagaagttaccgcttcagtattgggcaattctaatcccgttgttttaccctta
attgagatcgtcagcaagactcgtttttacgattacgaagctaaatataccccaggatta
agtgaacatatcatacctccaagaatagctccggaattaagtcaaaaagctattgaatac
gcccggaaaacgtataaagctttaggttgccgcggatttgcgcgagtggattttatgatt
gatgtaagaaaaaatgaagcctatgtcttggaagtaaatactattccgggaatgaccgcc
accagtttatttcccgacgcagcaaaagctcagggaataagctttgaggacctggtggaa
aaaatacttatgctcggtttagaggggaggcaaaaataa

DBGET integrated database retrieval system