KEGG   Carboxydothermus hydrogenoformans: CHY_2327Help
Entry
CHY_2327          CDS       T00287                                 

Gene name
tuf2
Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
chy  Carboxydothermus hydrogenoformans
Brite
KEGG Orthology (KO) [BR:chy00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:chy03012]
    CHY_2327 (tuf2)
   03029 Mitochondrial biogenesis [BR:chy03029]
    CHY_2327 (tuf2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:chy04147]
    CHY_2327 (tuf2)
Translation factors [BR:chy03012]
 Eukaryotic Type
  Elongation factors
   CHY_2327 (tuf2)
 Prokaryotic Type
   CHY_2327 (tuf2)
Mitochondrial biogenesis [BR:chy03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    CHY_2327 (tuf2)
Exosome [BR:chy04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CHY_2327 (tuf2)
  Exosomal proteins of breast cancer cells
   CHY_2327 (tuf2)
  Exosomal proteins of colorectal cancer cells
   CHY_2327 (tuf2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase Septin cobW
Motif
Other DBs
NCBI-ProteinID: ABB16195
UniProt: Q3A9P8
LinkDB All DBs
Position
complement(2089329..2090531)
Genome map
AA seq 400 aa AA seqDB search
MAKAKFERVKPHVNIGTIGHVDHGKTTLTAAITTVLAKKGLAQQKRYDEIDNAPEERERG
ITINTAHVEYETEKRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPYIVVFLNKADMVDDPELMELVEMEVRDLLSTYEFPGDEVPVVAGSALKALE
CGCGKEDCPWCGKILELMDKVDEYIPTPQRDVDKPFLMPVEDVFTITGRGTVATGRVERG
RITIGEEVEIVGLMDAPRKTVVTGLEMFRKVLDEAVAGDNIGALLRGVDRKEIERGQVLA
KPGTIKPHRKFFAEVYVLTKEEGGRHTPFFNGYRPQFYFRTTDVTGVIHLPEGVEMVMPG
DNVKIHIELITPIAIEEGLRFAIREGGRTVGAGVVTAIEE
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaggcgaaatttgagcgggtaaaaccgcacgtaaacattgggacgataggtcac
gtagaccacgggaagaccaccttgaccgcagcaattactacggtgctggcgaagaaggga
ttagcccagcaaaagaggtacgatgagattgacaatgctccggaagaaagggaaagagga
attaccattaatacagcgcatgtggagtatgagaccgagaagcggcactatgcccacgta
gactgtccgggacacgctgactacgtaaagaacatgataactggagcggcgcagatggac
ggagctatcctggttgtgtctgcagccgatggtccgatgccgcagacgcgggagcacatt
ttgttagcccgtcaggtaggagttccctatattgtagtatttttaaacaaagcggacatg
gtagatgatccggagttaatggagcttgtagagatggaagtgcgggatcttttaagcacg
tacgagtttccgggggatgaagtaccggtagtagcggggtcggcattgaaggcattggag
tgcggttgcgggaaagaagattgtccgtggtgtgggaagatattggagttaatggacaag
gtagacgaatacattccgacaccgcagcgggatgtagataagccgttcttaatgccggta
gaggacgtatttaccattaccggacgtgggacggttgcgaccggccgggtagagcgggga
cggataaccataggagaagaagtggagatagtaggattgatggatgctccgcggaagacg
gtagtaacgggactggagatgttccggaaggtattagacgaagcggtagcaggggacaac
ataggagcgttattacggggagtagaccggaaggaaatcgagcgggggcaggtattggcg
aagcctggtacgataaagccgcaccggaagttttttgcggaggtatacgtattgacgaag
gaagaagggggacggcacacaccgttctttaatggataccggccgcagttttacttccgg
acgacggacgtaacgggagtaatccatttaccagaaggtgtagagatggtaatgcccggg
gataacgtaaagattcatattgagcttatcacaccgattgctattgaagaaggattgaga
tttgctattcgggaaggtggcagaactgtaggcgcgggcgttgttaccgcgatcgaagag
taa

DBGET integrated database retrieval system