KEGG   Campylobacter hyointestinalis: CHH_1593Help
Entry
CHH_1593          CDS       T04651                                 

Definition
(GenBank) phosphoenolpyruvate phosphomutase, putative
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
chyo  Campylobacter hyointestinalis
Pathway
chyo00440  Phosphonate and phosphinate metabolism
chyo01100  Metabolic pathways
chyo01120  Microbial metabolism in diverse environments
chyo01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:chyo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    CHH_1593
Enzymes [BR:chyo01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     CHH_1593
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase CTP_transf_like
Motif
Other DBs
NCBI-ProteinID: ANE33201
UniProt: A0A172ST20
LinkDB All DBs
Position
complement(1550181..1551485)
Genome map
AA seq 434 aa AA seqDB search
MKKLVYVPMAADIIHPGHLNIIKEAAKLGRVMVGLFSDRAIASYKRVPFMTYEQRKVIVE
NLKGVDEVVMQDEKEYEPNLIKYKPDFLVHGSDWNEGPLNGPRQRAIALMQTWGGKVVEP
QYTKDVSSTKFNKSIKELGIMPHIRLAALKKSLNAKPMIKGIEAHSGLSAMIVEDASVKD
ENGVNQSFDLIWLSSLTDSSAKGKPDIEFVDLTSRMTTVNDILEVCTKPIIYDGDTGSEI
PHFALTVKRLERLGVSAVVIEDKMGLKKNSLLEGSAAKHTQDSIEHFCEKIKAGKNAQIT
DDFMIIARIESLILGVGMDDAILRAKKYIEAGADGIMIHSRKKDGAEILAFCEIYNKFEN
RKPLMVVPTNYPILSEEDLQKAGANIIVYANQLLRASYTAMLNTATSILTHKRALEADKN
YISALELISLIKGN
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaaacttgtttatgtgcctatggcagcagatatcattcatcctggtcatttaaat
atcataaaagaagctgcaaagcttggacgcgtcatggttgggctattttcagatagggca
atagcaagttataaaagagtgccttttatgacatatgaacaaagaaaggttatagttgaa
aatttaaaaggcgtcgatgaagttgtaatgcaagatgaaaaagagtatgagccaaattta
ataaaatacaagcctgattttttagtccatggtagcgactggaatgaaggaccattaaat
ggtccaagacaaagagctattgcattgatgcaaacttggggtggaaaagtagtagagcct
caatatacaaaagatgtttcatctactaaatttaataaaagtataaaagagcttggaata
atgccacatatccgcctagctgcactcaaaaaatctctaaatgctaaacctatgataaaa
ggcatagaagctcatagtggactaagtgcgatgatagttgaagatgcgagtgtaaaagat
gaaaacggcgtgaatcaaagttttgatttgatttggttaagttcgcttaccgactctagt
gcaaaaggtaaaccagatattgaattcgttgatttgacatcaagaatgacgactgtaaat
gacatacttgaggtttgcacaaagcctataatatatgatggagatacaggttcagagata
ccacattttgcattaactgtaaaaaggttggaaagacttggtgttagtgctgttgttata
gaagataaaatgggacttaaaaagaattcgctacttgaaggaagtgccgcaaaacatact
caagatagtatagagcatttttgtgagaaaattaaagctggtaaaaacgctcaaatcaca
gatgattttatgataatagctcgtatagaaagtcttattttaggggtcggtatggatgat
gccatattaagagcaaaaaaatatatagaagcgggggctgatggcataatgatacattca
cgtaaaaaagatggcgctgaaattttggcattttgcgaaatttataataaatttgaaaat
agaaagcctttgatggttgtgcctactaattatcctattttaagcgaagaagatctacaa
aaagccggtgcaaatataattgtttatgcaaatcaacttttaagggcttcatatactgct
atgttaaatactgcaacatccatactcacgcataaaagagcacttgaagccgataaaaac
tatatttctgcacttgagcttataagtttaattaaaggtaattaa

DBGET integrated database retrieval system