KEGG   Chryseobacterium sp. StRB126: CHSO_0089Help
Entry
CHSO_0089         CDS       T03602                                 

Gene name
glpA
Definition
(GenBank) FAD-dependent glycerol-3-phosphate dehydrogenase subunit
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
chz  Chryseobacterium sp. StRB126
Pathway
chz00564  Glycerophospholipid metabolism
chz01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:chz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CHSO_0089 (glpA)
Enzymes [BR:chz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     CHSO_0089 (glpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored GIDA FAD_binding_3 Pyr_redox_3 NAD_binding_8 Thi4 HI0933_like Pyr_redox_2
Motif
Other DBs
NCBI-ProteinID: BAP29126
UniProt: A0A077KCR9
LinkDB All DBs
Position
84995..86593
Genome map
AA seq 532 aa AA seqDB search
MKRNEELSKLTNVKEWDFIVIGGGASGLGSALDAVSRGFKTLLLESHDFAKATSSRSTKL
VHGGVRYLAQGDIGLVKEALKERGLLAKNAAHIVKNQSFIIPNYTWWGGIYYKIGLSVYD
FLAGKLSLGKTKYISKSKTIEKLPTIEQNHLASGVVYQDGQFDDARLAVNLAQTIIEKGG
SAVNYVKVVNLLKDDKDKVIGVVAEDQISKQQYQIHAKVVVNATGVFTNDILNMNNPKHG
KLVVPSQGIHLVLDKSFLKSDDAIMIPKTSDGRVLFVVPWHDRALVGTTDTLLENESFEP
RALEEEISFVLNTARQYLSKKPTRDDVKSVFAGLRPLAAPKDGSKSTKEVSRSHKVIASD
TGLISIIGGKWTTYRKMAEDTIDKAMQVHKLGNSTSKTENMSIHGNVKPEQVDRTNHLYV
YGSDIPAIKALQESNSRFSQKIHPDHPFTVAEVVWAARNEMAETIEDVLARRARLLFLDA
RAAIDSAHNVARIIAEEKGYSEEWAQQQENEFIELAKGYLLTPYSPKVINLN
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaaacgaagaactcagtaaattaaccaatgtaaaagaatgggactttattgtc
ataggaggaggagccagtggtttaggttcagcattagacgcagtaagcagaggattcaaa
actttattgcttgaatctcatgactttgcgaaagcaacatccagcagaagtaccaaactg
gtacacggcggagtaagatatttagcacagggagatataggtttagtgaaagaagcttta
aaagaaagaggtcttttagccaaaaatgcagcacatattgtaaaaaatcaatctttcatt
atccctaattatacctggtggggcggaatctattataagataggcttgtctgtatatgat
ttccttgcagggaaattaagtttgggtaaaacaaaatacatcagcaaatcaaaaaccatt
gaaaagctgcctactattgaacaaaatcacttagcaagtggtgttgtttaccaggacgga
cagtttgatgatgcaagacttgcagtcaacttagctcaaaccattattgaaaaaggagga
agtgcagtaaactacgtgaaggtagttaatcttctgaaagatgataaagataaagtaatt
ggagtggttgctgaagatcagatctccaaacagcaatatcagattcatgcaaaagtggtt
gttaatgctaccggtgttttcaccaacgacatccttaatatgaataaccctaaacatggt
aaacttgtagtaccaagtcagggaattcacttggtattggataaatcattcctgaaaagt
gatgatgccatcatgattccgaaaacttctgacggaagagtattgttcgttgtaccttgg
catgacagagctttggtaggaactacagatactcttttagaaaacgaaagtttcgagccc
cgtgctttggaagaagaaatcagtttcgttttgaatacagcaagacaatatctgtctaaa
aaaccaacccgtgatgatgtaaagtctgtttttgccggacttcgtcctcttgcagctcca
aaagatggaagcaagagcaccaaagaagtttcccgaagccataaggttattgcatctgac
actggattaatttccatcattggcggaaagtggactacttaccgtaaaatggctgaagat
acaattgataaagccatgcaggtacacaagctgggcaacagcacttctaaaacagaaaac
atgtctattcatggaaatgtaaaacctgagcaagtagatagaacaaaccatctatatgta
tacggatctgacattcctgcaataaaagctttacaggaaagcaattcacgcttttcgcaa
aaaatacatcctgaccatccattcaccgtagcagaagtagtttgggctgcaagaaatgaa
atggcagaaaccatcgaggatgtattggcaagaagagcccgtctgttgttccttgatgca
agagccgctatagacagcgcgcacaatgttgcgagaatcattgctgaagaaaaaggatat
tctgaagaatgggcacagcaacaggaaaatgaatttattgaattggcaaaaggatattta
ttaactccttattcacctaaagttatcaaccttaattaa

DBGET integrated database retrieval system