KEGG   Chryseobacterium sp. StRB126: CHSO_0568Help
Entry
CHSO_0568         CDS       T03602                                 

Definition
(GenBank) NUDIX family hydrolase
  KO
K03574  8-oxo-dGTP diphosphatase [EC:3.6.1.55]
Organism
chz  Chryseobacterium sp. StRB126
Brite
KEGG Orthology (KO) [BR:chz00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:chz03400]
    CHSO_0568
Enzymes [BR:chz01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.55  8-oxo-dGTP diphosphatase
     CHSO_0568
DNA repair and recombination proteins [BR:chz03400]
 Eukaryotic Type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    CHSO_0568
 Prokaryotic Type
    CHSO_0568
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX
Motif
Other DBs
NCBI-ProteinID: BAP29605
UniProt: A0A077KC00
LinkDB All DBs
Position
693006..693701
Genome map
AA seq 231 aa AA seqDB search
MELPKKLQDIKVAVDAVIFGYFDKKDLQILLIKRNIEPFKGGWALPGGLVLDDENLDDAV
KRELHEEAGIKPDFLEQLYTFGNVGRDPRNRVVSVAYLGLVNPSYHELFADSDADDAQWF
SVNQLPLVAFDHKNIIDIALKRLRTKIQYQPIGFNLLNEEFPFSDLENLYKTIVGQEIDR
RNFRKKIMSYGLLNETNNVKKEGSGRPGKLFTFNQEKYKELEEQGFYFEIK
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atggagcttccaaaaaaattacaggatatcaaagtggctgtagacgcggttattttcgga
tatttcgataaaaaagatctacaaatccttttaatcaaaagaaatattgaaccttttaag
ggggggtgggctcttccgggaggtcttgttctggatgatgaaaatctggatgatgccgta
aaaagagaacttcatgaagaggcgggcataaagcctgactttttagaacaactctataca
tttggtaacgttggccgggatccgagaaatagagtggtttctgtggcttatttgggcctc
gtaaacccttcttaccatgagctgtttgcagattcagatgcagatgatgcccaatggttc
agtgtgaatcaacttcctttagttgcttttgaccataaaaatatcattgatattgcctta
aaaaggcttcgtaccaaaattcaatatcagccaatcggctttaatcttctcaatgaagaa
tttcctttctcagaccttgagaacctttacaaaactattgtgggacaagaaattgaccgc
agaaacttccgtaaaaaaatcatgagctatggtttgcttaatgagaccaataacgtcaaa
aaagaaggaagcggaagaccaggaaagctttttacctttaatcaggaaaaatataaagag
ctggaagaacaaggcttctacttcgaaatcaaatag

DBGET integrated database retrieval system