KEGG   Chryseobacterium sp. StRB126: CHSO_2331Help
Entry
CHSO_2331         CDS       T03602                                 

Gene name
dlaT
Definition
(GenBank) putative dihydrolipoyllysine-residue acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
chz  Chryseobacterium sp. StRB126
Pathway
chz00010  Glycolysis / Gluconeogenesis
chz00020  Citrate cycle (TCA cycle)
chz00620  Pyruvate metabolism
chz01100  Metabolic pathways
chz01110  Biosynthesis of secondary metabolites
chz01120  Microbial metabolism in diverse environments
chz01130  Biosynthesis of antibiotics
chz01200  Carbon metabolism
Module
chz_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:chz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CHSO_2331 (dlaT)
   00020 Citrate cycle (TCA cycle)
    CHSO_2331 (dlaT)
   00620 Pyruvate metabolism
    CHSO_2331 (dlaT)
Enzymes [BR:chz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CHSO_2331 (dlaT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H GSK-3_bind
Motif
Other DBs
NCBI-ProteinID: BAP31368
UniProt: A0A077KJP2
LinkDB All DBs
Position
2672689..2673957
Genome map
AA seq 422 aa AA seqDB search
METASAEVPAGVEVITMPRLSDTMTEGKVAKWHKNVGDTVKEGDLLAEIETDKAVQDFES
EFNGVLLKQGVEEGGAAPVDTVLAIIGPAGTDVSAVGASKVAAPASEKPAEQKAEVKTEE
KAAPVANNSSSDRVAISPLAKKMAQDKGVDINSVQGSGENGRIVKKDIENYQPAAKPAAS
APAASAAAQVAVNFVQGEDTETPNSQVRNIIAKRLSESKFSAPHYYLMVEINMDKAIEAR
KEINSIPDTKISFNDMIIKATAIALRKHPQVNSSWAGDKIIHRGNINVGVAVAIPDGLVV
PVLKNTDQMSYTQISAAVKDMASRAKSKGLKANEMEGSTFSISNLGMFGIETFTSIINQP
NSAILSVGAIIEKPIVKNGQIVVGNTMKLSLACDHRVVDGATGAQFLQTLRTYLENPLTL
LL
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
gtggaaactgcttcagcagaagttccggcaggagtagaagtgattacaatgccaagactt
tctgatacaatgacggaaggaaaagttgctaaatggcacaaaaatgtaggtgatacagta
aaagaaggtgatcttcttgctgaaattgaaacagataaagcggtacaggatttcgaatct
gaattcaatggagtactattgaagcaaggtgtagaagaaggtggtgctgctccggttgat
actgtgttggctattattggccctgcaggaactgatgtttcagcagtaggagcatctaaa
gttgctgctccggcatcagagaaaccagcggaacaaaaagcagaagttaaaactgaagaa
aaagcagctccggttgctaacaattcatcttcagacagagtggcaatttctccattagct
aaaaaaatggctcaggataaaggagttgacattaacagtgttcaaggttcaggtgaaaac
ggaagaatcgttaaaaaagatattgaaaactatcagccagctgcaaaaccagctgcttca
gctccggctgcaagtgctgctgctcaggttgctgtaaactttgttcagggagaagatact
gagactccaaactctcaggtaagaaatattattgcaaaacgtctttctgaaagtaagttc
tctgctccgcactattatttaatggttgaaatcaacatggataaagctatcgaagctaga
aaagagatcaactctattccggatacgaagatttcattcaatgatatgattattaaggca
acagcaattgctttaagaaaacacccacaagtaaattcaagctgggcaggtgataagatc
atccacagaggaaatatcaacgttggagtggcagttgctattcctgacggattggtagtt
cctgtattgaaaaatacagatcaaatgtcttacactcaaatctctgcagctgtaaaagat
atggcttcaagagctaagagtaaaggtcttaaggctaacgaaatggagggatctacattc
tctatttctaaccttggaatgtttggtattgaaacatttacaagtatcatcaaccagcca
aactctgccatcctttcagtaggagcaatcatcgagaaaccaatcgttaagaatggtcag
atcgtagtgggtaatacaatgaagctttcattagcatgtgaccacagagttgtagatggt
gctactggtgctcaattcttacaaactttaagaacatatttagaaaatccattaactttg
ttactgtaa

DBGET integrated database retrieval system