KEGG   Chryseobacterium sp. StRB126: CHSO_4148Help
Entry
CHSO_4148         CDS       T03602                                 

Definition
(GenBank) cytoplasmic alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
chz  Chryseobacterium sp. StRB126
Pathway
chz00500  Starch and sucrose metabolism
chz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:chz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CHSO_4148
Enzymes [BR:chz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     CHSO_4148
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1939 Alpha-amylase
Motif
Other DBs
NCBI-ProteinID: BAP33185
UniProt: A0A077KM85
LinkDB All DBs
Position
complement(4710210..4711649)
Genome map
AA seq 479 aa AA seqDB search
MKKTHFILSLLALALVSSCQNHDELSTESVKKEEVHDKIVNVTQHDGRPFSTGSESGSVK
GKFVAGPGGSVLMQGFYWDVPDGGNWWNTVKDKLTAWSNAGIGAVWLPPASKAQNGAYSM
GYDPTDYYDFGNFNQNGSTETRFGSRAELEALITKAHAENMQVYADIVINHNSGGQSEAN
PFTGTNTWTNFSGVASGKFQRNYNDFYKNAYGNNDEGAFGGFPDLCHANPHVQDWLWERD
DSVAKYYKNVMKFDGWRFDYVKGFGPWVVNTWNSKVGGFSVGELWDSNVNTLEWWANNAN
SSVFDFAAYYKMDEAFDNGNLNVLNDDMMWKRNPYKAVTFVANHDTDVIYNKMPAYAYIL
THEGYPTIFYRDYEEWLNKERLNNLIWIHNNKATGTTSILYTDNDEYIARRNGYNGNPGL
VVYINTSSNWQERWIDTNWTSQQIKDFTGHSSWYPTTQGDKRVKIQCPPNSYSVWSLNL
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaacacattttattctttccctactggctttagcacttgttagctcatgccaa
aatcatgatgaattgagtacggaatctgtgaagaaggaagaagtacacgataaaatagta
aatgtaacccaacatgacggaagacctttcagtacaggaagtgaatccggatccgtgaaa
gggaaatttgttgcaggcccaggtggtagtgttttgatgcaggggttttactgggatgtt
cctgatgggggcaactggtggaatactgttaaagataaattaacagcgtggtccaatgca
gggattggtgctgtatggctcccaccggcttcaaaagctcaaaatggagcatattccatg
ggatatgaccctactgattattacgattttggaaattttaatcagaatggaagtacagaa
accagatttggatcaagagcagagctggaagcattgattacaaaagcccatgcagaaaat
atgcaggtctatgctgatattgttatcaaccataatagtggtggccaatctgaagcgaat
ccatttaccggaacaaacacctggaccaatttttcaggggtcgcttccggaaaatttcaa
agaaactacaatgacttttataaaaatgcctacggaaacaatgatgagggtgcctttggt
ggattcccggatctatgtcatgctaaccctcatgtacaggactggttgtgggaaagagac
gattcagtggcgaaatattataaaaatgtaatgaaatttgatggctggagattcgattat
gtaaaaggatttggaccttgggtcgtgaatacctggaattctaaggtaggaggcttttct
gtaggtgaattatgggattcgaatgtcaatacgctggaatggtgggctaataatgccaac
agttccgtatttgattttgccgcatattataaaatggatgaagcttttgacaacggaaac
ctgaatgtgttgaatgatgatatgatgtggaaaagaaatccatacaaagcagtcaccttc
gttgccaatcatgatacggatgttatctacaacaaaatgcctgcctatgcttatatttta
acacatgaaggttatcccactattttttacagagactatgaagaatggttaaacaaagaa
aggctcaacaatctgatctggattcacaataataaagctacaggaaccacttccatttta
tatacggataatgatgaatacattgcaaggcgtaacgggtacaacggaaatccggggctg
gtagtgtatatcaatacctcctcaaactggcaggaaagatggattgataccaattggacg
agtcagcagatcaaagattttacaggacattcgagctggtatccgacgacacagggggat
aagcgggtgaaaattcagtgtccaccgaatagttattctgtgtggtcgcttaacttatga

DBGET integrated database retrieval system