KEGG   Clostridium isatidis: BEN51_05615Help
Entry
BEN51_05615       CDS       T05663                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
cia  Clostridium isatidis
Brite
KEGG Orthology (KO) [BR:cia00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cia01001]
    BEN51_05615
Enzymes [BR:cia01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     BEN51_05615
Protein kinases [BR:cia01001]
 Serine/threonine kinases: Other
  Bacterial family
   BEN51_05615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA Kinase-like DUF4448 Haspin_kinase PBP1_TM APH Pkinase_fungal Kdo Orf78 Fructosamin_kin
Motif
Other DBs
NCBI-ProteinID: ASW42966
UniProt: A0A343JBQ8
LinkDB All DBs
Position
complement(1191253..1193205)
Genome map
AA seq 650 aa AA seqDB search
MIGVILGGRYEILEKIGEGGMSEVYKAKCHKLNRFVAVKVLKKQFADNEEISQKFKKEAT
AIANLSDANIVNILDVGTQDTIDYIVMEYINGKTLKDLIKFNGKLSYTTAINIALQIAKA
LDCAHRNNIIHRDIKPQNILVTESGEIKVTDFGIAKSVDSQTITNTTSVIGSAHYLSPEQ
ARGTYIDFRTDIYSLGVVLYEMVTGVLPFEGDSPVTVALKHIQEDPIPPKNLNSSIPSSL
NNLILKAIQKEPIKRYINAKELIQDLNKIKENPDVIIGDNKEQNDERTIVMSPILGKNQN
KEKENYIQEDTNEDDDYYDDEEYDEEYDEDLKEKPKKKKNVKKKVFITIGSILGVILLLF
VGYYLAVGGGNSEVEVPKLVGLKSEDAVKELEKIGLRLEIIKTEVSDKEENTILSIDPKE
GTKVKKNTSIKAVVSGGEETYNMPDFRNYEITNIKHILETQGFSNYTITEEFSDDVEYGY
LIRQNPAAKTKIKKDAAIQIIISKGPEVKLVEVPSVVGKSEKDGKGDLQALKLTVTVETK
TTYDKAEDGIILSQSISGNKVEEGTPITIIVGKFEERIIDVRKEIGLSEGQTLSVAKARL
EVAGLGIDIKGPKDDDAIVVSFTETVKEGGTVTLNTQKETNQQEENKPQQ
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atgataggagtaattcttggtggaagatatgagatcctagaaaaaataggcgaagggggc
atgtctgaagtatataaggctaagtgtcataaattaaatagatttgttgcagttaaagta
cttaaaaagcaatttgcagataatgaggaaatttcgcagaaatttaaaaaagaagctaca
gctattgctaacctatcagatgcaaatatagttaatattttagatgttggcactcaagat
actatagattatatagtaatggaatatattaatggaaaaactttaaaggatttaattaaa
tttaacggaaaactgtcatatactacagcaataaacattgcattgcaaattgctaaagct
ttagattgtgctcatagaaataacataattcatagggatataaagccacaaaatatcttg
gttactgaatcaggggaaataaaggttaccgattttggaatagcaaaatcagtagattca
caaacaataacaaataccactagtgttattggatcagcacactatctttcaccagaacaa
gccagaggaacatatatagattttagaactgatatttattctcttggagtagtactatat
gaaatggttactggagttttaccttttgagggagattcaccagttaccgtagctttaaaa
catatacaagaagatcctatacctccgaagaatttaaattcatcaattccgtcaagttta
aataacttgatattaaaagctattcaaaaagaaccaataaaaagatatataaatgcaaag
gaactaattcaagatttaaataaaataaaagaaaatccagatgttattattggtgataac
aaagagcaaaatgatgaaagaacaatagttatgtcacctattttagggaaaaaccaaaat
aaagaaaaagaaaactatatccaagaggatactaatgaagatgatgactattatgatgat
gaagaatatgatgaagaatatgatgaagatttaaaagaaaagccaaagaagaagaaaaat
gttaaaaagaaggtttttataacaataggttccatattaggagtaattcttcttttattt
gttggttattatttagctgttggaggaggaaatagtgaagtagaggttcctaagctcgtt
ggattaaagtcagaagatgcagttaaggaattagagaaaataggtttaagattagaaata
ataaaaacagaagttagtgataaggaagaaaatacaatattaagtatagatcctaaagaa
ggtactaaagttaagaaaaataccagtataaaagcggtagtttctggtggagaagaaact
tataatatgccagactttagaaactatgaaatcactaatattaaacatattttagagacc
cagggcttttcaaattatactattacagaagaatttagtgatgatgtagaatatggttat
ttaattagacaaaatccagcagccaaaacaaaaattaaaaaggatgcagcaattcaaata
attattagcaaaggaccggaagtaaaattagttgaagtaccaagtgttgttggcaaatct
gaaaaagatggaaaaggagatttgcaagcattaaagttaactgttacagtagagactaaa
acaacttatgataaagcagaagatggtataatattatctcaatctatttcaggcaataaa
gttgaggaaggtactccaattactataattgttggtaaatttgaagagagaataattgat
gttcgaaaagaaataggtttaagcgaaggacagactctttcagttgcaaaggcaagactt
gaagttgcaggtttaggaatagacattaaaggcccaaaagatgatgatgcaatagtagta
tctttcacagaaacagttaaagaaggtggaactgtaacacttaatacgcaaaaagaaaca
aatcaacaagaagaaaataaaccacaacaataa

DBGET integrated database retrieval system