KEGG   Citrus clementina (mandarin orange): CICLE_v10001179mgHelp
Entry
CICLE_v10001179mg CDS       T02982                                 

Definition
(RefSeq) hypothetical protein
  KO
K04122  ent-kaurene oxidase [EC:1.14.14.86]
Organism
cic  Citrus clementina (mandarin orange)
Pathway
cic00904  Diterpenoid biosynthesis
cic01100  Metabolic pathways
cic01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cic00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00904 Diterpenoid biosynthesis
    CICLE_v10001179mg
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:cic00199]
    CICLE_v10001179mg
Enzymes [BR:cic01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.86  ent-kaurene monooxygenase
     CICLE_v10001179mg
Cytochrome P450 [BR:cic00199]
 Cytochrome P450, plant type
  CYP701 family
   CICLE_v10001179mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 18043147
NCBI-ProteinID: XP_006431592
UniProt: V4SVN2
LinkDB All DBs
Position
Unknown
AA seq 441 aa AA seqDB search
MATKEYIIQAFQVVPFATSIALGILSVFFFSFFIRRFISRRRMELAVKLPPVPEVPGRLP
LIGNLLQLKEKKPHMTFTRWAEVYGPIYSIKTGASTMIVLNSADVAKEAMVTRYPSISTR
KLSNALKMLTSNKCMVATSDYDEFHKMAKRCLLTNVLGGNAQKRHRIHRDTMMENMSTQF
HAHIKDNPLQLVNFRKIFESELFAVSMKQAVGKVVESIYVKELGSTLSKDEVFKILVLDI
MEGAIEVDWRDFFPYLRWVPNKGVEMKIQRLCTRRQAVMDALISEAKSRIALGQELNCYV
DHLLSEVKSLTEQQISMLLWEPIIETSDTTLVTTEWAMYELAKDPMRQDRLFQKIQSVCR
SNKFTEENIAQVPYLGAVFHETLRKYSPAPIVPLRFAHEDTEIGGYFIPAGSEICNKHIW
MLHGTRNNGKTPEEWKPERFL
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atggccaccaaagagtacatcattcaagcatttcaagtggtaccctttgccacctccatt
gctcttggtattctctctgtgtttttcttctcgttcttcatcagaaggttcatctctagg
cggaggatggaattagctgttaaacttccacctgttccagaggttccaggaaggctaccc
cttataggaaatttgttacagttgaaagagaagaaaccacacatgactttcacaagatgg
gcagaggtgtatggaccaatttattctatcaagactggagcttctactatgattgttctc
aattccgctgatgttgctaaagaggccatggtgaccagatatccatccatttcaacaagg
aagctatcaaatgccctgaagatgctcacctctaataaatgtatggttgcaacaagtgac
tacgatgaatttcacaaaatggctaaacgatgtttactcacaaatgttttgggtggaaat
gctcagaagcgacatcgaatccatagagacacaatgatggaaaatatgtcaacccaattt
catgctcacatcaaggacaatcctctacaactagtgaatttcaggaaaatatttgagtct
gaactttttgcagtgtcaatgaaacaggctgtaggaaaggttgtggaatcaatttatgtg
aaggagcttggttccacattgtctaaagatgaggtatttaaaattttagtgcttgacata
atggagggagcaattgaggtggactggagagatttcttcccttatctaagatgggttcct
aataaaggcgtggaaatgaaaattcagagattgtgtacccgcaggcaagcagtaatggat
gccctcatcagtgaggccaaaagcagaattgctttaggacaggagctgaattgttatgtt
gatcacttgttgtcagaagtaaaatcacttacagagcaacaaataagcatgctgctctgg
gagcctatcatcgagacatcagatactactttggtcacaacagaatgggccatgtatgag
ctggcaaaggatccaatgcgacaggaccgtctatttcagaagattcaatcagtttgccgg
tcaaacaagtttacggaggaaaacatagcacaggttccttacttgggagctgttttccat
gaaactctgagaaagtacagtccagctccaatagttcctttgcgatttgcacatgaagat
accgaaataggtggatacttcattcctgctggaagtgagatttgcaataaacatatatgg
atgctacatgggaccagaaacaatgggaaaaccccggaggagtggaaacccgagagattt
ctttga

DBGET integrated database retrieval system