KEGG   Citrus clementina (mandarin orange): CICLE_v10008720mgHelp
Entry
CICLE_v10008720mg CDS       T02982                                 

Definition
(RefSeq) hypothetical protein
Organism
cic  Citrus clementina (mandarin orange)
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf Striatin
Motif
Other DBs
NCBI-GeneID: 18054003
NCBI-ProteinID: XP_006451749
UniProt: V4WEK8
LinkDB All DBs
Position
Unknown
AA seq 364 aa AA seqDB search
MAQLPPKIPNMSHNWSSFPYQRMSFISSNNNNNNDNNNNNIANAATTMTLNNNNNIHHNQ
PHWVDEFLDFSSVRRGAHRRSISDSVAFLDPPSSLVVVEECRNSNNSNNNNNNSTINNIM
SSSDANYCFDRLDDEQLMSMFSDDISVSVPPTASSSNPSTPSDQNSNNDEKVTAPSDQQQ
QQKQQQQQPKNEPGEVESSCKNNEPSSSQTTTHQTPPASNGDTIIDPKRVKSRILANRQS
AQRSRVRKLQYISELERSVTTLQTEVSALSPRVAFLDHQRLILNVDNSALKQRIAALAQD
KIFKDAHQEALKKEIERLRQVYHQQNIKKMKNNNNSNNNATPPPQQPPSQPMNTDTIVCM
DKDQ
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggcacaattgcctccaaaaataccaaatatgagccacaattggtcttcatttccttac
caacgaatgtcctttatttcttctaataacaacaataacaacgacaacaacaataacaat
attgccaatgctgccaccaccatgacccttaacaacaacaacaatatccaccacaatcaa
ccccattgggttgacgagttcctcgacttctcctccgtccgacgaggggcgcaccgccgg
tccatcagcgactccgtcgccttcctcgacccaccgtcgtcgttggttgttgttgaagaa
tgtaggaatagtaacaactctaataataacaataataatagcaccataaataacattatg
tcatcatcggacgccaattactgctttgataggcttgatgatgagcaactcatgtccatg
ttctccgacgacatatcggtgtcggtcccgcctacggcttcctcatcaaacccttccacg
ccgtctgatcaaaatagcaacaatgatgagaaagttactgcaccgtcggatcaacaacaa
caacaaaagcagcagcagcagcagcccaagaatgagcctggagaagtggaaagctcgtgc
aagaataacgagccatcatcatcacaaaccaccacgcaccagacgcctcctgcctctaat
ggtgataccatcatcgatccaaaaagagttaagagcagaattttggcaaatcggcaatca
gcacagaggtcaagagtgaggaaattacaatatatttcagagcttgaacggagtgttaca
acattgcagactgaagtatcagcattgtcaccgagggttgcatttttggatcatcaaagg
ttgattctgaatgttgacaatagtgctttgaagcaacggattgctgctttggctcaagac
aagatcttcaaagatgctcatcaagaggccctaaagaaagaaatagagagactaaggcaa
gtttatcaccaacaaaacatcaagaaaatgaagaacaacaacaacagcaacaacaatgca
acaccgccaccgcaacaaccaccatcacagccaatgaacactgacaccatcgtatgtatg
gacaaggatcagtaa

DBGET integrated database retrieval system