KEGG   Citrus clementina (mandarin orange): CICLE_v10012143mgHelp
Entry
CICLE_v10012143mg CDS       T02982                                 

Definition
(RefSeq) hypothetical protein
  KO
K01240  uridine nucleosidase [EC:3.2.2.3]
Organism
cic  Citrus clementina (mandarin orange)
Pathway
cic00240  Pyrimidine metabolism
cic00760  Nicotinate and nicotinamide metabolism
cic01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cic00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    CICLE_v10012143mg
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    CICLE_v10012143mg
Enzymes [BR:cic01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.3  uridine nucleosidase
     CICLE_v10012143mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IU_nuc_hydro
Motif
Other DBs
NCBI-GeneID: 18038155
NCBI-ProteinID: XP_006430245
UniProt: V4SWQ6
LinkDB All DBs
Position
Unknown
AA seq 338 aa AA seqDB search
MDRVMANENSHGSGVVLGSSTNPAKLIIDTDPGIDDSMTILMAFQTPELEILGLTTIFGN
VTTEDATRNALTLCEMAGCPGVPVAEGSPEPLKGGKPRVAEFAHGSDGMGNISLTPPKAK
KCDKNASEFLVDKVSEYPGEVSILALGPLTNLALAIKRDSSFASKVKNIVVLGGAFFALG
NVNPAAEANIYGDPEAADVVFTSGANIAVVGINITTQVKLTDADLLELRQSKGRYVQLLG
DMCKFYRDWHVKSDGVHGIFLHDPVSFVALVRPDLFTFKKGVVRVETQGICTGHTLMDQG
LKRWNVSNPWTGYSPVSVAWTVNVDKVLNYIKRLLMKQ
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atggatagagttatggcgaatgaaaattctcacggcagcggcgtcgttttgggatcttct
actaaccccgccaagctcattatcgatactgaccccggaatcgatgatagcatgacaatc
ttaatggcatttcaaactccggaattggagatcttggggttgacaacaatctttggtaat
gttactactgaagacgccactcgcaatgccttgactctgtgtgaaatggcagggtgtcca
ggtgttcctgtggcagaaggcagccctgagcctttgaagggtggaaagcctcgggttgct
gaatttgctcatggttctgatgggatgggaaatatatctctaacgcctccaaaagcaaag
aaatgtgataagaatgcatctgaatttctagttgataaagtctcagaatatccaggggaa
gtatctatacttgctcttggaccactaactaacttggctttggcaatcaaaagggactca
tcctttgcaagtaaggtgaaaaacattgttgtacttggtggtgctttctttgcattggga
aatgtcaatcctgcggctgaagcgaatatttatggagaccctgaagcagcagatgttgtg
tttacctctggggcaaacattgctgttgttggaataaacattactacgcaagtcaaactg
acagatgccgacttgcttgaattgaggcaatctaaaggaaggtatgttcagctattgggt
gacatgtgcaaattttaccgagactggcatgtgaagtctgatggtgtccatggcattttc
ctacacgaccctgttagttttgtggcattagttcggccagatctcttcacattcaagaag
ggagttgtgagggttgagacgcaaggaatatgtacggggcatacactaatggatcaagga
ctgaaaagatggaatgttagtaatccatggacaggctattcccctgtttcagttgcttgg
acggtcaatgtggataaagtgctcaattatattaaaagactgctgatgaaacaatga

DBGET integrated database retrieval system