KEGG   Citrus clementina (mandarin orange): CICLE_v10014962mgHelp
Entry
CICLE_v10014962mg CDS       T02982                                 

Definition
(RefSeq) hypothetical protein
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
cic  Citrus clementina (mandarin orange)
Pathway
cic00010  Glycolysis / Gluconeogenesis
cic00051  Fructose and mannose metabolism
cic00052  Galactose metabolism
cic00500  Starch and sucrose metabolism
cic00520  Amino sugar and nucleotide sugar metabolism
cic01100  Metabolic pathways
cic01110  Biosynthesis of secondary metabolites
cic01200  Carbon metabolism
Module
cic_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cic_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cic00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CICLE_v10014962mg
   00051 Fructose and mannose metabolism
    CICLE_v10014962mg
   00052 Galactose metabolism
    CICLE_v10014962mg
   00500 Starch and sucrose metabolism
    CICLE_v10014962mg
   00520 Amino sugar and nucleotide sugar metabolism
    CICLE_v10014962mg
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    CICLE_v10014962mg
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cic04131]
    CICLE_v10014962mg
Enzymes [BR:cic01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     CICLE_v10014962mg
Membrane trafficking [BR:cic04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    CICLE_v10014962mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 Fusion_gly
Motif
Other DBs
NCBI-GeneID: 18050513
NCBI-ProteinID: XP_006446203
UniProt: V4TGE3
LinkDB All DBs
Position
Unknown
AA seq 510 aa AA seqDB search
MGRRGVVAVAAVGVAVAACVVAGVVVGKRVKSRRKWKRVMGVLRELEEGCETTVSRLRQV
VDAMAVEMHAGLASEGGSKLKMLLTFVDNLPTGSEKGIYYALDLGGTNFRVLRVQLGGQR
SSILSSDVERQPIPPELMTGTSEDLFDFIASALQQFVEKEGNGSEPPPIRRRELGFTFSF
PVKQTSVSSGILIKWTKGFAIESMVGQEVAESLQRALDKRGLDMRVAALVNDTVGTLALG
HYHDEDTVAAVIIGTGTNACYLERTDAIIKCQGLLTTSGGMVVNMEWGNFWSSHLPRTSY
DIDLDAESPNPNDQGFEKMISGMYLGDIVRRVILRMSEESDIFGPASSRLSMPFILRTPL
MAAMHEDDSPELTEVARILNDVLEIPDVPLKVRKLIVKICDVVTRRAARLAAAGIVGILK
KIGRDGSGGISSGRSRSDIRMRRTVVAIEGGLYSSYTLFREYLHEALTDILGDDIAQHVI
LKVTEDGSGIGAALLAASHSSYSVDTVQPL
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atggggcgaagaggggtggtagcggtggcggcggttggggtggcggtggcggcgtgtgtg
gtggcgggagtggtggtgggtaaaagagtgaagagcaggaggaagtggaagagagtgatg
ggtgttttgagagagttggaagaaggttgtgagactactgtttcaagattaaggcaagtt
gttgatgctatggctgttgagatgcatgctggcttggcttctgaaggtggctctaagctc
aaaatgttgctcacttttgttgataaccttcctactgggagtgagaaaggaatttattat
gctcttgatcttgggggtactaattttagggtcttaagggtccagttaggaggtcaaagg
tcctctattctatcatcagatgtggaacgacaacccattcccccagaattgatgactggc
acaagtgaggatctctttgattttatagcttcagcgttgcagcaatttgttgaaaaagaa
ggaaatggttctgagcctcctccaatcagaagaagagaacttggatttacattctctttc
cccgtcaaacagacgtctgtgtcatcagggattctaatcaaatggaccaaaggatttgca
attgaaagcatggttggacaagaagtcgctgaaagcttacaacgagctctggacaagaga
ggcttagatatgcgggtagctgcactggtaaatgatactgtcgggactttagctcttggg
cattatcatgatgaggacactgttgctgcagtgataattggaacgggcactaatgcatgc
tatttggaacggacagatgcgattatcaagtgtcagggacttcttacgacctctggaggc
atggttgtcaatatggaatggggtaatttctggtcatctcatttgcctagaacttcatat
gatattgatttagatgcagaaagtcctaatccaaatgatcagggttttgagaaaatgata
tcgggaatgtatttgggtgatatcgttaggagagtgattctcaggatgtcagaggagtct
gatatctttggacctgcttcttccaggttatcaatgcccttcatcttgaggacaccgttg
atggcagctatgcatgaagatgactccccagagttgacagaagtagcaagaatcttgaat
gatgttctcgagattccagacgtacctttaaaggtccggaagctcattgtaaaaatatgt
gacgtagtaacacgcagagctgctagattagctgcagctggtattgttgggatcttgaag
aagattgggcgggacgggagtggtggtattagtagtgggcgaagtaggagtgatattcga
atgagaagaacggttgttgcaatcgaagggggtttgtattcaagctatacattattcaga
gagtacttgcacgaagccttgactgacattttaggtgacgatattgcccaacatgtcata
cttaaggttacagaagacggatcaggcattggagcagcccttttagccgcctcgcattca
tcctatagtgtggataccgtacagccgctataa

DBGET integrated database retrieval system