KEGG   Citrus clementina (mandarin orange): CICLE_v10015082mgHelp
Entry
CICLE_v10015082mg CDS       T02982                                 

Definition
(RefSeq) hypothetical protein
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
cic  Citrus clementina (mandarin orange)
Pathway
cic00061  Fatty acid biosynthesis
cic00780  Biotin metabolism
cic01100  Metabolic pathways
cic01212  Fatty acid metabolism
Module
cic_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:cic00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CICLE_v10015082mg
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CICLE_v10015082mg
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    CICLE_v10015082mg
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:cic01004]
    CICLE_v10015082mg
Enzymes [BR:cic01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     CICLE_v10015082mg
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     CICLE_v10015082mg
Lipid biosynthesis proteins [BR:cic01004]
 Fatty acid synthase
  Component type
   CICLE_v10015082mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase
Motif
Other DBs
NCBI-GeneID: 18053019
NCBI-ProteinID: XP_006445926
UniProt: V4UAE1
LinkDB All DBs
Position
Unknown
AA seq 482 aa AA seqDB search
MIKNNSSKRPPSVSLQTGTVTTLQSLDLIELNYFKLSKASSAFVFFQRNPPKRERKKPFF
LTQYFSLFLTLALPIVQRYLFSSARVGALKMAATAACSLQMAAVKPCISSSHRGVKAGVA
VVGGNSKGALWTKLSSASHISSGQPFLRSFTSSSVKFDKVVTRAMAESSTNKPISGLPID
LKGKRAFIAGVADDNGYGWAIAKSLAAAGAEILVGTWVPALNIFETSLRRGKFDESRVLP
DGSLMEITKIYPLDAIYDKLEDVPEDVKSNKRYSGSSKWTVQECAESVKQDFGSIDILVH
SLANGPEVSKPLLETSRNGYLAALSASSYSYVSLLKHFIPLMNPGGSSLSLTYIASERII
PGYGGGMSSAKAALESDTRVLAFEAGRKHRIRVNAISAGPLRSRAAKAIGFIDTMIEYSL
ANAPLQKELSADEVGNTAAFLASPLASAITGAVIYVDNGLNAMGVGVDSPIFKDLDIPTD
KH
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaaacaacagttccaaacgtcctccatcagtttctctccaaacagggacagtc
acgacactacaaagcctcgatctcatcgaactcaactactttaaactctcgaaagcttca
tcagcttttgttttctttcagaggaacccccccaaaagagaaagaaaaaagccatttttt
ttaactcaatacttctctcttttcctcacattggcgcttccaatcgttcaaaggtattta
ttttcctctgcaagagttggtgcattgaaaatggcggcaacagcagcttgtagccttcaa
atggcagcagtaaagccatgcatttcctcttctcacagaggtgtcaaagcaggtgttgca
gttgttggtggcaactccaagggggcattgtggaccaagctttctagtgcttctcacata
tcatctgggcaacctttcctgcggagttttacatcatcttcagtaaaatttgataaggtt
gtaacaagggcaatggctgaatctagcactaacaagcctatttccggattgcctattgat
ttgaaaggtaagagggcatttattgctggtgtagctgacgacaacggatatggttgggct
atagcaaaatctcttgctgctgcaggagctgaaattttggttggaacatgggttcctgct
ttgaacatttttgaaaccagtctgcgacgtggaaaatttgatgaatctcgtgtgttgcca
gatggttctttgatggaaatcactaaaatatatcccctagatgctatctatgacaagctt
gaggatgtgcctgaggatgtaaaatcaaacaagcgctattcagggtcctctaaatggact
gttcaggaatgtgctgaatctgtcaaacaggattttggcagcattgacatcctagtgcac
tcacttgccaatggaccagaggtgagcaagcctctgttggagacttcaaggaacgggtat
cttgcggctttatctgcttcgagttactcttatgtttctctactcaagcatttcattcca
ttaatgaacccaggtggttcttcactttcgcttacatacattgcttccgagaggatcatt
ccaggatatggtggaggaatgagttctgctaaagctgcactagagagtgacacacgagtg
cttgcttttgaagctgggagaaaacacagaatcagggtcaacgccatctcggctggtccg
ctgagaagtcgtgctgcaaaagcaattggattcattgatacaatgattgaatattcatta
gccaatgcaccattgcagaaagaattatctgcagatgaggtggggaacactgctgccttc
ttagcatcacctttggcctccgccatcaccggtgctgtaatctatgttgacaatggtctg
aatgcaatgggagtcggagtcgacagtccaatatttaaagaccttgacattccaacagac
aagcactag

DBGET integrated database retrieval system