KEGG   Citrus clementina (mandarin orange): CICLE_v10019240mgHelp
Entry
CICLE_v10019240mg CDS       T02982                                 

Definition
(RefSeq) hypothetical protein
  KO
K11407  histone deacetylase 6 [EC:3.5.1.98]
Organism
cic  Citrus clementina (mandarin orange)
Brite
KEGG Orthology (KO) [BR:cic00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cic01009]
    CICLE_v10019240mg
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:cic03019]
    CICLE_v10019240mg
   04131 Membrane trafficking [BR:cic04131]
    CICLE_v10019240mg
   03036 Chromosome and associated proteins [BR:cic03036]
    CICLE_v10019240mg
Enzymes [BR:cic01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     CICLE_v10019240mg
Protein phosphatases and associated proteins [BR:cic01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CICLE_v10019240mg
Messenger RNA biogenesis [BR:cic03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     CICLE_v10019240mg
Membrane trafficking [BR:cic04131]
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    CICLE_v10019240mg
Chromosome and associated proteins [BR:cic03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     CICLE_v10019240mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 18049031
NCBI-ProteinID: XP_006440744
UniProt: V4VMD3
LinkDB All DBs
Position
Unknown
AA seq 646 aa AA seqDB search
MEVKSGEGRTIKRRVGLLYDERMCKHNTPDGDYHPENPNRIKAIWNKLQAAGIPRRCVVL
NSKEAKDKNLLSVHTENHVNLIKNISSKQFDSRRDRIASKLNSIYLNEGSSEAAYLAAGS
VIEVAERVAEGELNSAFAIVRPPGHHAEPDEAMGFCLYNNVAVAASFLLNERPELGINKI
LIVDWDVHHGNSTQKMFWKDPRVLFFSVHRHEFGTFYPANDDGFYTMIGEGPGLGYNINV
PWENGRCGDADYLAVWDHILLPVAKDFGPDIIIISAGFDAAAGDPLGGCRVTPYGYSVML
KKLMDFAQGKIVLALEGGYNLGSISNSVLACMNVLLEDKPVAGSSEAYPFESTWRVIQAV
RKKLSAFWPTLADELPTKLTSLKAPPAHMISSSDSEDEDTKVETLEAVLQVALSKLKVDD
GHAELGMATPWRSELSKVDVFYASFGSNMWKSRFLCYIEGGQVEGMQKPCSGSKDRNPPK
EILWKTFPHHLFFGHDSSHTWGPGGVAFLNPECDCRHKAYLCLYRITLEQFNDVLLQENV
YSDDVSSPLFDTNDLNSVANKKAVSLEALKNGWYHNVVYLGKEHGIPILTMTCSLSAVGK
FKSGEFPLRAPAPPYTNTLIKGLVEGKQLSEEEAKAYIHEASTKRL
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atggaggtgaaatcaggtgagggcaggaccataaaacgacgcgtgggcctactgtacgat
gagagaatgtgtaaacataacacacctgacggtgattatcaccccgagaaccccaaccgc
atcaaagctatttggaacaagctccaagccgctggcattcctcgacggtgtgtcgtttta
aattccaaagaagcgaaagacaaaaatctactgtctgtgcacacggaaaatcatgttaat
ttgattaagaatataagctcaaagcagtttgattcccgaagagataggattgcgtcaaaa
ttaaattcaatttacttaaatgaaggatcatcggaggctgcttatcttgctgccggttca
gttatagaggtcgccgagagagttgccgaaggggagttgaattctgcttttgctattgtg
agacctcctggtcatcatgctgaaccagatgaagctatgggattttgtctatacaacaat
gtggctgttgctgcaagtttcctattaaatgaaagaccagaactgggaatcaataaaatt
ttgattgttgattgggatgttcaccatggtaacagtactcaaaagatgttctggaaggat
ccccgtgtcctattcttctctgttcataggcatgagtttggaactttttatcctgccaat
gatgatggtttctatactatgattggtgaaggacctggtttgggatacaacattaatgtc
ccttgggagaatgggaggtgcggtgatgcagactatctggcagtttgggaccatatttta
cttcctgttgcaaaggattttggacctgacataatcataatatctgctggattcgatgca
gccgctggtgatcctttaggaggctgccgtgtcacaccatatggatactcagttatgtta
aaaaagttgatggattttgctcaaggtaagattgttttggcattggaaggaggctacaat
cttggctctatatcaaattcagtccttgcatgcatgaatgttttgctggaagacaagcct
gttgctggatcttcagaggcctatccatttgagtcaacatggcgtgtgatacaagcggtt
cgtaaaaaattaagtgctttctggccaacactagcagatgaactaccaaccaagttaact
agtttaaaagctcctcctgcgcatatgatatcaagctctgattctgaagatgaggatacg
aaggtagaaacccttgaggcagttctccaggttgccctttcgaagctgaaagttgatgac
ggtcacgctgaactggggatggctaccccatggagatcagaactctcaaaagttgatgtt
ttttatgctagttttggatcgaatatgtggaaatcaagattcctctgctatattgaaggt
ggacaggtagaaggtatgcaaaagccatgttctggttcaaaggataggaacccaccgaaa
gagattttgtggaaaactttccctcaccatttattctttggtcatgattcctctcacaca
tggggtcctggaggggttgcttttcttaaccctgaatgtgactgtcgacataaagcttac
ttgtgtctgtacagaattacgctagaacagttcaatgatgttttacttcaggaaaatgtc
tatagtgatgacgtgagttctcctttatttgatacgaatgatttaaactctgttgcaaac
aagaaggctgtttccttggaggctctcaagaatggctggtatcataatgttgtttacctg
gggaaggagcatggtatcccaatactgacaatgacgtgctcactttcagctgttggaaaa
ttcaaatcaggggagttccccttgcgtgcccctgccccgccatataccaataccttaata
aaaggcctggtagaagggaaacagctctcggaagaggaagccaaggcttacatacacgaa
gcttccactaagcgactgtga

DBGET integrated database retrieval system