KEGG   Citrus clementina (mandarin orange): CICLE_v10019465mgHelp
Entry
CICLE_v10019465mg CDS       T02982                                 

Definition
(RefSeq) hypothetical protein
  KO
K03294  basic amino acid/polyamine antiporter, APA family
Organism
cic  Citrus clementina (mandarin orange)
Brite
KEGG Orthology (KO) [BR:cic00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    CICLE_v10019465mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AA_permease_2 AA_permease Spore_permease
Motif
Other DBs
NCBI-GeneID: 18049847
NCBI-ProteinID: XP_006445402
UniProt: V4TYI3
LinkDB All DBs
Position
Unknown
AA seq 436 aa AA seqDB search
MGGENVQIEKSNNNSSSSSSPSASGPPPTCFSHFWSSALRAKTLTAPSVRTNDGEGLLRR
LGLFELVLIGVGASVGAGIFVVTGTVARDAGPGVTISFLLAGAASVLNALCYAELASRFP
AVVGGAYLYAYTAFNELTAFLVFAQLMLDYHIGAASIARSLASYVVSILELFPFFKENIP
SWIGHGGEEFLGGTLSINILAPILLALLTIVLCWGVGESSVLNSCMTVVKVIIVIVVIFA
GAFEVDVSNWSPFAPNGFKEILTGATVVFFAYVGFDAVANSAEESKKPQRDLPIGILGSL
LICAALYVGVSLVLTGMVPYKFLDEDAPLSDAFASRGLKYVSVLISFGAVAGLTTTLLVG
LYVQSRLYLGLGRDGLLPSIFAKVHPKRHTPVHSQVWVGIVAGILAGLFNVRVLSHILSV
GTLVGHSQFLPLIYLV
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgggaggtgaaaacgttcagatcgaaaaaagcaacaataattcgtcatcgtcatcatca
ccatctgcgtcaggtccaccacccacgtgtttctctcatttctggtcttcagctctccga
gccaaaaccctaactgctccgtccgtccgtacaaatgatggcgaaggacttttacggcgg
ctcggactcttcgaactggtgctcatcggcgtcggcgcgtctgttggcgccggaatattc
gttgtcaccggtaccgtggctcgcgacgccggtccaggagttacaattagtttcttactt
gctggagcagcttctgtgttaaatgcactctgttatgctgagctggcatctcgttttcct
gccgttgttgggggagcatacttgtatgcgtatacagcattcaatgaacttacagctttt
cttgtttttgcacaacttatgttggactaccatattggtgcagcgagcatagcacgaagc
ttagctagctatgtagtttcaattttggagctctttccctttttcaaagaaaacatacca
agctggattggacatggtggtgaagagttcttgggaggaactctatccatcaatatatta
gctccaattctccttgcacttctgactatagttttatgttggggtgtcggtgaatcttct
gttttgaactcgtgcatgaccgttgtaaaggttatcattgtcattgttgtaatctttgct
ggtgcttttgaggttgatgtttccaattggtccccatttgctccaaatggtttcaaagaa
atattgactggagctactgtagtattctttgcgtatgtagggtttgatgcagttgctaat
tcagctgaagaatctaagaagcctcagcgggatttgccgataggcatcttgggaagcctt
cttatatgtgctgcattatacgtcggtgtctctttagttctcaccgggatggtaccttac
aaattccttgatgaagatgctcctctgtctgatgcttttgcgtccaggggtttgaaatat
gtttcagtgttaatcagctttggtgctgtggctggacttacaacaaccctccttgttggt
ctttatgttcagtcacggttatatcttgggcttggaagggatggcctactgccttctata
tttgctaaagtgcacccaaaacggcacactcctgttcattcccaggtttgggttggcatt
gttgctggtattttggcagggctatttaacgtgcgtgtgctctcacacattctttcagtt
ggcacattggtaggtcatagtcagttcttgcctttgatatatttagtgtaa

DBGET integrated database retrieval system