KEGG   Citrus clementina (mandarin orange): CICLE_v10019831mgHelp
Entry
CICLE_v10019831mg CDS       T02982                                 

Definition
(RefSeq) hypothetical protein
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
cic  Citrus clementina (mandarin orange)
Pathway
cic00250  Alanine, aspartate and glutamate metabolism
cic00410  beta-Alanine metabolism
cic00430  Taurine and hypotaurine metabolism
cic00650  Butanoate metabolism
cic01100  Metabolic pathways
cic01110  Biosynthesis of secondary metabolites
Module
cic_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:cic00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CICLE_v10019831mg
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CICLE_v10019831mg
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CICLE_v10019831mg
   00430 Taurine and hypotaurine metabolism
    CICLE_v10019831mg
Enzymes [BR:cic01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     CICLE_v10019831mg
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 18046053
NCBI-ProteinID: XP_006441361
UniProt: V4TXH0
LinkDB All DBs
Position
Unknown
AA seq 498 aa AA seqDB search
MVISTTETDSREILSSTFASRYVRAAIPRFKMPDNSMPKEAAYQVINDELMLDGNPRLNL
ASFVTTWMEPECDKLVMASINKNYVDMDEYPVTTELQNRCVNMIAHLFNTPVADDKTAVG
VGTVGSSEAIMLAGLAFKRKWQQKRKEQGKPYDKPNIVTGANVQVCWEKFARYFEVELKE
VKLEEGYYVMNPVKAVELVDENTICVAAILGSTLTGEFEDVKLLHDLLTKKNEETGWDTP
IHVDAASGGFIAPFLYPDLEWDFRLPLVKSINVSGHKYGLVYAGVGWVVWRTKDDLPDEL
VFHINYLGSDQPTFTLNFSKGSSQIIAQYYQFIRLGFEGYKNIMENCMGNARALREGLEK
TGRFEILSKDVGVPLVAFSLKDSSAHTVFEISEGLRKFGWIVPAYTMPANAENVAVLRVV
VREDFSRSLVERLISHIEEVLKEIESLPSRVSTKTAHVIPMVNETQGDKPLKKSVRETQE
EVTRHWKRFVKGRRAGAC
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggtgatttcaacaacagaaacagactccagggagattttgagctccacatttgcttca
agatatgtccgtgctgctattcccagattcaagatgccagataattcaatgccaaaggag
gcagcctatcaggtaataaatgatgagctgatgttagatggaaatccaaggctgaacttg
gcatcttttgtgaccacttggatggagcccgagtgtgataagcttgtcatggcttcgatt
aataaaaactatgttgacatggatgaataccctgtaaccacagagctccagaatcggtgt
gtgaatatgattgcccacctatttaatactccagttgcggatgacaagactgcagtgggc
gtggggactgtaggttcatcagaggcaataatgcttgctggcttggcttttaaaaggaag
tggcagcagaagagaaaagagcaaggcaaaccctatgataagcccaatatagtcactgga
gctaatgtgcaggtatgctgggagaaatttgcgaggtactttgaggttgagctgaaggag
gtgaaactggaagagggatattatgtgatgaatcctgtgaaagctgttgagttggtagat
gagaacaccatttgtgttgcagccattctgggatcaaccttgacgggagaatttgaggat
gttaagcttcttcatgacctcctcaccaaaaagaatgaggagaccggttgggacaccccc
attcatgttgatgctgctagcggcggatttattgctccttttctctatccagaccttgaa
tgggatttccgtttgccactggtgaagagcattaatgtcagtggtcacaagtacggcctt
gtatatgcaggtgttggctgggttgtctggaggaccaaagatgacttgccggatgaactt
gtctttcacatcaactaccttggatctgatcaaccgactttcaccctcaacttctcaaaa
ggctccagtcaaataattgctcaatattatcagtttatacggcttggctttgagggttac
aagaacattatggaaaattgcatggggaatgctagagcgctaagagaaggattagagaaa
acagggcgctttgaaattctctccaaggatgttggcgtacccttagtagccttttctttg
aaggacagcagcgcacacaccgtgtttgagatatccgagggtttgagaaagtttgggtgg
atagttccggcctatacaatgcctgctaatgctgaaaatgtggcggttcttcgggtggtt
gtcagggaggatttcagccgtagcttggtggaaagactcatctcacacatcgaggaagtt
ttgaaggaaattgaatcgcttccaagtcgtgtatccacgaaaactgcccatgtcataccc
atggtcaacgaaactcagggtgataagccacttaagaagagtgtgagggagactcaggag
gaagtcaccaggcactggaagaggttcgtgaaaggccggagagctggagcatgctga

DBGET integrated database retrieval system